BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0117 (443 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1263 + 25279899-25279985,25280263-25282372,25282700-252827... 28 2.9 07_03_0485 + 18630758-18630786,18631331-18631458,18631490-186316... 27 9.0 >07_03_1263 + 25279899-25279985,25280263-25282372,25282700-25282793, 25283178-25283314,25283419-25283454,25283602-25283642, 25284036-25284125,25284229-25284284,25284947-25285030, 25285072-25285150 Length = 937 Score = 28.3 bits (60), Expect = 2.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 212 IENRLILFVFNIIDL*CSFGEYCDNI 135 I L+LF + II L C F +CDN+ Sbjct: 868 ISTSLLLFFYLIIQLRCMFLVFCDNL 893 >07_03_0485 + 18630758-18630786,18631331-18631458,18631490-18631627, 18632077-18632273 Length = 163 Score = 26.6 bits (56), Expect = 9.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 103 YGSIVKHYDISILSQYSPKLHYRSIILKTNNI 198 Y S V Y + L +LH++ I+ KTNNI Sbjct: 133 YNSWVTIYHV--LENKQRRLHFKGIVFKTNNI 162 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,925,839 Number of Sequences: 37544 Number of extensions: 163547 Number of successful extensions: 220 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 847740284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -