BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0117 (443 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U49449-1|AAB00117.1| 339|Caenorhabditis elegans olfactory recep... 29 1.5 U42830-6|AAC48279.2| 339|Caenorhabditis elegans Odorant respons... 29 1.5 AF024502-3|AAB70373.1| 836|Caenorhabditis elegans Hypothetical ... 27 4.6 Z81592-9|CAB63315.1| 945|Caenorhabditis elegans Hypothetical pr... 27 6.1 >U49449-1|AAB00117.1| 339|Caenorhabditis elegans olfactory receptor Odr-10 protein. Length = 339 Score = 29.1 bits (62), Expect = 1.5 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +1 Query: 205 FSIRPQTLNNNKSFPIDSKQRIYFYVCV--VSNKW*CV*CFLY*FKVSFMHYLKKILALC 378 F +RP N +F + S++R + + +++ + C CF F VS +H++ + A C Sbjct: 61 FILRPIMHIENTTFFLISRKRFNYSTKLGKINSAFYCA-CFATSFVVSGVHFVYRYFATC 119 Query: 379 TPSL 390 P+L Sbjct: 120 KPNL 123 >U42830-6|AAC48279.2| 339|Caenorhabditis elegans Odorant response abnormal protein10 protein. Length = 339 Score = 29.1 bits (62), Expect = 1.5 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +1 Query: 205 FSIRPQTLNNNKSFPIDSKQRIYFYVCV--VSNKW*CV*CFLY*FKVSFMHYLKKILALC 378 F +RP N +F + S++R + + +++ + C CF F VS +H++ + A C Sbjct: 61 FILRPIMHIENTTFFLISRKRFNYSTKLGKINSAFYCA-CFATSFVVSGVHFVYRYFATC 119 Query: 379 TPSL 390 P+L Sbjct: 120 KPNL 123 >AF024502-3|AAB70373.1| 836|Caenorhabditis elegans Hypothetical protein M151.3 protein. Length = 836 Score = 27.5 bits (58), Expect = 4.6 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 88 YKFTHYGSIVKHYDISILSQYSPKLHYRSIILKTNNINLFSIRPQ 222 + TH + KHY + S+ +PK Y L+ + +L ++R Q Sbjct: 25 FNLTHCATSYKHYAFQLASKIAPK-RYNDAFLEHSEEHLNALRKQ 68 >Z81592-9|CAB63315.1| 945|Caenorhabditis elegans Hypothetical protein T16G1.9 protein. Length = 945 Score = 27.1 bits (57), Expect = 6.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 202 LFSIRPQTLNNNKSFPIDSKQRIYFYVCVVSN 297 L SI+P + N + FP D K ++YF C +N Sbjct: 279 LISIKPHSARNFE-FPKDGKLKVYFDDCSSAN 309 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,777,485 Number of Sequences: 27780 Number of extensions: 186885 Number of successful extensions: 360 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 767282256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -