BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0110 (367 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces... 24 6.4 SPBC2G5.05 |||transketolase |Schizosaccharomyces pombe|chr 2|||M... 24 6.4 SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr ... 24 6.4 SPAC343.15 |||tRNA isopentenyltransferase|Schizosaccharomyces po... 24 8.5 >SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 24.2 bits (50), Expect = 6.4 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -3 Query: 278 KLWNTR*RLWLDLPQHSLLRGGAP*RKCSRSAGAPISAVR 159 K W + W + P L R A K ++ A P+ A+R Sbjct: 16 KDWQRYVKTWFNQPGRKLRRRQARQTKAAKIAPRPVEAIR 55 >SPBC2G5.05 |||transketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 685 Score = 24.2 bits (50), Expect = 6.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 91 PVLAEWVGRDRGSLTSGYLCRL 26 P +W+ RDR L++G+ C L Sbjct: 55 PAHPKWLNRDRFILSNGHACVL 76 >SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 377 Score = 24.2 bits (50), Expect = 6.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -2 Query: 276 ALEHTLTSLVGPATAQSPTRRRTLAQVQPERGGSNIGS 163 +L H S P ++P + T + PE GS IGS Sbjct: 329 SLYHGAVSADVPEQTEAPISK-TAGSINPEDSGSEIGS 365 >SPAC343.15 |||tRNA isopentenyltransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 434 Score = 23.8 bits (49), Expect = 8.5 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -1 Query: 130 DPSAGLRTVEAICPVLAE-WVGRD 62 DPSA L ++ I PV+AE W RD Sbjct: 141 DPSAMLSYLKKIDPVMAEQWHPRD 164 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,439,924 Number of Sequences: 5004 Number of extensions: 24059 Number of successful extensions: 61 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 114084208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -