BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0109 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 27 0.43 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 25 2.3 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 3.0 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 3.0 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 24 4.0 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 24 5.3 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 24 5.3 AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse t... 23 7.0 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 9.2 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 27.5 bits (58), Expect = 0.43 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 451 DEQVWDKIFDVNVKSSWLLAKEAYPELVKRGGGSIVFISS 570 DE+V KIF +SSW E Y ++ R + FI++ Sbjct: 280 DEKVAVKIFFTTEESSWFRETEIYQTVLMRNENILGFIAA 319 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/44 (27%), Positives = 25/44 (56%) Frame = +1 Query: 1 NQLCGIENNNNKLVLFCCYSGTKRSVVLLINKSLNISTSANPVR 132 NQ+ G+E ++ + +SG + ++V L K +++ T A V+ Sbjct: 371 NQITGLEGYKVEVTMKTSFSGMQTALVKLPVKLVSVVTGAGKVQ 414 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.6 bits (51), Expect = 3.0 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = -1 Query: 326 QTTPSTVMPSLRRLCTAFPTLLSFRLQMTTEAPSLPSLLAIAYPIPSVDAVTIATFPLNR 147 QTTP + R L T FPT+ +++ +L L+ Y D V + T L+ Sbjct: 519 QTTPVPTSTTSRPLRTPFPTVRKEDIEIQQHLDAL-KLMLTPYMKEHKDTVALNTTKLST 577 Query: 146 VL 141 ++ Sbjct: 578 MM 579 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 24.6 bits (51), Expect = 3.0 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = -1 Query: 326 QTTPSTVMPSLRRLCTAFPTLLSFRLQMTTEAPSLPSLLAIAYPIPSVDAVTIATFPLNR 147 QTTP + R L T FPT+ +++ +L L+ Y D V + T L+ Sbjct: 518 QTTPVPTSTTSRPLRTPFPTVRKEDIEIQQHLDAL-KLMLTPYMKEHKDTVALNTTKLST 576 Query: 146 VL 141 ++ Sbjct: 577 MM 578 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/38 (26%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 97 SLNISTSANPVRAIQSTR-FSGKVAIVTASTEGIGYAI 207 +L+ + +P + + R FSG+ A++T ++ YA+ Sbjct: 147 NLDCLSKCSPTKCVPFCRPFSGQTALLTPESQSANYAL 184 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +1 Query: 277 AVQSLRSEGITVEGVVCHVANHEHRRRLFEVATSK 381 A L + + E +CH+ H H L E +S+ Sbjct: 30 ASPGLSTSDLKREATICHMLKHPHIVELLETYSSE 64 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.8 bits (49), Expect = 5.3 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 455 SSVSKIEATAG-LTAAFDTRISTPPNLLVATS 363 +S++ ATA +T T+ STPPN + A S Sbjct: 273 ASLTTAAATAAAMTTTTTTKKSTPPNAIPALS 304 >AJ970245-1|CAI96717.1| 134|Anopheles gambiae putative reverse transcriptase protein. Length = 134 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 515 SLANSQELFTLTSNILSQTCSSVSKIEATAGLTAAFDT 402 SL+ + +L +T+NI+ C+ S A AFD+ Sbjct: 43 SLSTTHQLHRVTNNIVHNRCNRKSTGLALLDTEKAFDS 80 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 252 PEREQRWESCAEPPKR 299 P RW SC PP R Sbjct: 262 PRSGGRWPSCRSPPAR 277 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.132 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,514 Number of Sequences: 2352 Number of extensions: 15583 Number of successful extensions: 113 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -