BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0108 (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 27 0.57 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 26 0.75 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 26.6 bits (56), Expect = 0.57 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 251 VPIEKLQDRRNWRDLCLMRLSLLKKEMNKKYQSS*C 358 VP+++ + W D L RL +K+ + YQ+ C Sbjct: 395 VPVQRPKPNPPWADRTLKRLKRVKRAAYRHYQTRRC 430 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 26.2 bits (55), Expect = 0.75 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 230 TPSFCFYLSSYAEPVPFHC*HDKLSLRIYQY 138 T +F F S A+P FHC H + L IY Y Sbjct: 403 TVAFSFRSSRPADPAMFHCNHPFVFL-IYDY 432 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,467 Number of Sequences: 2352 Number of extensions: 11083 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -