BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0106 (406 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1201 - 35380338-35380496,35381200-35381322,35381521-353820... 31 0.35 03_01_0082 + 653041-653137,653219-653496,653596-653689,653804-65... 31 0.46 07_03_0943 - 22778877-22780970,22781376-22781480,22781481-227820... 29 1.8 03_05_0520 + 25139314-25139364,25139580-25139711,25141594-251417... 28 2.4 01_01_0128 - 1167904-1168749,1168790-1168863,1169419-1169491,117... 28 3.2 11_01_0388 + 2933006-2934173,2934312-2934371,2934877-2935067 27 4.3 07_01_0886 - 7356591-7356662,7357002-7357079,7357373-7357444,735... 27 4.3 01_01_0057 - 435295-435731,435866-435914,436041-436437,437807-43... 26 9.9 >01_06_1201 - 35380338-35380496,35381200-35381322,35381521-35382066, 35382285-35382392,35382695-35383225,35383614-35383743, 35384225-35385081,35385303-35385408,35387119-35387230, 35389255-35389347,35389723-35389771,35389859-35389897, 35390671-35390757,35391613-35391873,35391957-35392166, 35392413-35393507 Length = 1501 Score = 31.1 bits (67), Expect = 0.35 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 163 EKYPHQA---WRFFGYRYRILKHQRALRCRNEEDGRRNEQIQIRTHEQRKQQFLQE 321 EKYP A RF G+R R+L + L E+G I +E+RK +FL+E Sbjct: 1213 EKYPVMAELIHRFQGFRERLLADPKFLHRLAIEEGISITTTLIAQYEKRKGRFLEE 1268 >03_01_0082 + 653041-653137,653219-653496,653596-653689,653804-653886, 654027-654247,654395-654533,654628-654710,654824-655036, 655099-655494,655587-655758,656085-656276,656363-656569, 656661-656753,656957-657156,657329-657838,658114-658184, 658322-658963,659057-659207,659425-659665 Length = 1360 Score = 30.7 bits (66), Expect = 0.46 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -2 Query: 210 SVSITEKSPSLMGIFLLRPLSAIFHVICRVEI-VETKQTLKRSRVNTFHWNNTH 52 S+ I+ S ++ ++L+P A IC + V++KQ+LK TF W +TH Sbjct: 884 SLLISVGSKQVLTTWVLQPKVAENRHICSSGLDVDSKQSLKGDSAMTFQWLSTH 937 >07_03_0943 - 22778877-22780970,22781376-22781480,22781481-22782059, 22782149-22782187,22782340-22782372 Length = 949 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 211 ILKHQRALRCRNEEDGRRNEQIQIRTH 291 + K +R + C+NE GRRN R H Sbjct: 629 VAKRRRLVSCKNERTGRRNTAANKRQH 655 >03_05_0520 + 25139314-25139364,25139580-25139711,25141594-25141731, 25143191-25143241,25143662-25143751,25143854-25144000, 25144108-25144218,25144307-25144375,25144777-25145517, 25145840-25146004,25146376-25146442,25146580-25146704, 25148714-25148983,25149065-25149199,25149316-25149497, 25149669-25149744 Length = 849 Score = 28.3 bits (60), Expect = 2.4 Identities = 9/31 (29%), Positives = 24/31 (77%) Frame = +2 Query: 197 VIDTEFSSIRERFDAEMRKMEEEMSKFRSEL 289 V DTE ++ +E+F+A+++K +++ ++R ++ Sbjct: 18 VYDTENANQKEKFEADLKKEIKKLQRYRDQI 48 >01_01_0128 - 1167904-1168749,1168790-1168863,1169419-1169491, 1171148-1171398,1171442-1171687,1172220-1172415, 1172796-1172876,1172966-1173169,1173671-1173880, 1173953-1174174,1174437-1174480,1174974-1175052, 1175066-1175227,1175337-1175564,1175786-1175815, 1175905-1176273,1176356-1176571,1177202-1177683, 1177930-1177975 Length = 1352 Score = 27.9 bits (59), Expect = 3.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 205 YRILKHQRALRCRNEEDGRRNEQIQIRTHEQRK 303 Y L+ QR R R EE+ R+ E+ + R +RK Sbjct: 837 YLNLEEQRLQRLREEEEARKQEERRKREETERK 869 >11_01_0388 + 2933006-2934173,2934312-2934371,2934877-2935067 Length = 472 Score = 27.5 bits (58), Expect = 4.3 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +3 Query: 21 EGSVL-SCQPSSAYYSSETCLRENVSVFV*FLQFPRGK*REKWLTVVSREISPSS 182 +GSV+ SC +S YY S + L+ + V V LQ E+ L + R +SPSS Sbjct: 239 KGSVIVSCDTTSMYYKSLSTLQSLLLVCVKKLQPKLVVTIEEDLVRIGRGVSPSS 293 >07_01_0886 - 7356591-7356662,7357002-7357079,7357373-7357444, 7357511-7357600,7357669-7357783,7358509-7358639, 7358717-7358992,7360147-7360283,7360368-7360502, 7360958-7361325,7362111-7362229,7362295-7362339 Length = 545 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 146 ADSGLKRNIPIKLGDFSVIDTEFSSIRERFDAEMRKMEEE 265 A S + ++P+ L D S +E S++R DA K EE+ Sbjct: 52 ASSSRRSSVPLPLPDPSSSRSETSAVRSEGDAAEEKSEEQ 91 >01_01_0057 - 435295-435731,435866-435914,436041-436437,437807-437906, 438316-438388,439322-439528 Length = 420 Score = 26.2 bits (55), Expect = 9.9 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 24 GSVLSCQPSSAYYSSETCLRENVSVFV*FLQFPRGK*REKWLTVVSRE 167 G++ S SA+Y + N+ + + FL+ R K REK L+ + E Sbjct: 149 GTLASRHIFSAHYFRYSSKNSNIPLSIFFLRHAREKVREKELSPIGEE 196 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,735,614 Number of Sequences: 37544 Number of extensions: 145415 Number of successful extensions: 436 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 706675332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -