BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0106 (406 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 0.60 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 1.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 3.2 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 22 9.8 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 22 9.8 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 22 9.8 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 22 9.8 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 22 9.8 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 22 9.8 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 22 9.8 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.8 bits (54), Expect = 0.60 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 220 HQRALRCRNEEDGRRNEQIQIRTHEQRKQQFLQEH 324 +++A R R E+D +NE ++ ++Q QEH Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQEH 238 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.6 bits (51), Expect = 1.4 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 209 EFSSIRERFDAEMRKMEEEMSKFRSELMNRESN 307 E R + +++ E+E++ FR+EL E+N Sbjct: 678 EMQKKRSEYSQLIQEHEKELADFRAELKQTEAN 710 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 3.2 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 214 LKHQRALRCRNEEDGRRNEQIQIRTHEQRKQQFLQEHN 327 L+HQ + + ++ ++ +Q Q H+Q +Q LQ H+ Sbjct: 1300 LQHQYQQQLQQQQQQQQQQQQQ---HQQHQQHQLQHHH 1334 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 21.8 bits (44), Expect = 9.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 9 GIRHEGSVLSCQPSSAYYSSETCLRENVSV 98 G+RH+G SC+ + S + LR + V Sbjct: 100 GMRHKGPFESCRDEPSKMSGKYLLRASNDV 129 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 21.8 bits (44), Expect = 9.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 9 GIRHEGSVLSCQPSSAYYSSETCLRENVSV 98 G+RH+G SC+ + S + LR + V Sbjct: 100 GMRHKGPFESCRDEPSKMSGKYLLRASNDV 129 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 21.8 bits (44), Expect = 9.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 9 GIRHEGSVLSCQPSSAYYSSETCLRENVSV 98 G+RH+G SC+ + S + LR + V Sbjct: 100 GMRHKGPFESCRDEPSKMSGKYLLRASNDV 129 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 21.8 bits (44), Expect = 9.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 9 GIRHEGSVLSCQPSSAYYSSETCLRENVSV 98 G+RH+G SC+ + S + LR + V Sbjct: 100 GMRHKGPFESCRDEPSKMSGKYLLRASNDV 129 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 21.8 bits (44), Expect = 9.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 9 GIRHEGSVLSCQPSSAYYSSETCLRENVSV 98 G+RH+G SC+ + S + LR + V Sbjct: 100 GMRHKGPFESCRDEPSKMSGKYLLRASNDV 129 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 21.8 bits (44), Expect = 9.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 9 GIRHEGSVLSCQPSSAYYSSETCLRENVSV 98 G+RH+G SC+ + S + LR + V Sbjct: 100 GMRHKGPFESCRDEPSKMSGKYLLRASNDV 129 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 21.8 bits (44), Expect = 9.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 9 GIRHEGSVLSCQPSSAYYSSETCLRENVSV 98 G+RH+G SC+ + S + LR + V Sbjct: 100 GMRHKGPFESCRDEPSKMSGKYLLRASNDV 129 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 343,983 Number of Sequences: 2352 Number of extensions: 6314 Number of successful extensions: 72 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32494788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -