BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0102 (610 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) simila... 188 2e-48 At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) simila... 188 2e-48 At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ri... 187 6e-48 At1g48830.2 68414.m05465 40S ribosomal protein S7 (RPS7A) simila... 184 3e-47 At1g48830.1 68414.m05464 40S ribosomal protein S7 (RPS7A) simila... 184 3e-47 At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 29 3.2 At1g59870.1 68414.m06745 ABC transporter family protein similar ... 29 3.2 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 29 3.2 At1g52960.1 68414.m05990 hypothetical protein very low similarit... 28 5.6 At1g64590.1 68414.m07321 short-chain dehydrogenase/reductase (SD... 27 7.4 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 27 7.4 At4g08113.1 68417.m01331 myosin heavy chain-related similar to M... 27 9.7 At3g15800.1 68416.m02000 glycosyl hydrolase family 17 protein si... 27 9.7 >At3g02560.2 68416.m00247 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 188 bits (459), Expect = 2e-48 Identities = 93/185 (50%), Positives = 135/185 (72%), Gaps = 2/185 (1%) Frame = +3 Query: 12 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 185 KI K G FE ++QAL +LE TN +LK++L++LYI +A ++++ N+K+++IYVP Sbjct: 7 KIHKDKGVAPTEFEEQVTQALFDLENTNQELKSELKDLYINQAVQMDISGNRKAVVIYVP 66 Query: 186 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 365 KAF+KI +RLVRELEKKFSGK V+FV R+I+ P + V +RPR+RTLTSV Sbjct: 67 FRLRKAFRKIHLRLVRELEKKFSGKDVIFVATRRIMRPPKKGSAV----QRPRNRTLTSV 122 Query: 366 YNAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREV 545 + A+LED+ +PAEIVGKR R +LDG++++KV LD + E+K++T VY+KLTG++V Sbjct: 123 HEAMLEDVAYPAEIVGKRTRYRLDGTKIMKVFLDSKLKNDTEYKLETMVGVYRKLTGKDV 182 Query: 546 TFEFP 560 FE+P Sbjct: 183 VFEYP 187 >At3g02560.1 68416.m00246 40S ribosomal protein S7 (RPS7B) similar to ribosomal protein S7 GB:AAD26256 from [Secale cereale] Length = 191 Score = 188 bits (459), Expect = 2e-48 Identities = 93/185 (50%), Positives = 135/185 (72%), Gaps = 2/185 (1%) Frame = +3 Query: 12 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 185 KI K G FE ++QAL +LE TN +LK++L++LYI +A ++++ N+K+++IYVP Sbjct: 7 KIHKDKGVAPTEFEEQVTQALFDLENTNQELKSELKDLYINQAVQMDISGNRKAVVIYVP 66 Query: 186 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 365 KAF+KI +RLVRELEKKFSGK V+FV R+I+ P + V +RPR+RTLTSV Sbjct: 67 FRLRKAFRKIHLRLVRELEKKFSGKDVIFVATRRIMRPPKKGSAV----QRPRNRTLTSV 122 Query: 366 YNAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREV 545 + A+LED+ +PAEIVGKR R +LDG++++KV LD + E+K++T VY+KLTG++V Sbjct: 123 HEAMLEDVAYPAEIVGKRTRYRLDGTKIMKVFLDSKLKNDTEYKLETMVGVYRKLTGKDV 182 Query: 546 TFEFP 560 FE+P Sbjct: 183 VFEYP 187 >At5g16130.1 68418.m01884 40S ribosomal protein S7 (RPS7C) 40S ribosomal protein S7 homolog - Brassica oleracea, EMBL:AF144752 Length = 190 Score = 187 bits (455), Expect = 6e-48 Identities = 95/185 (51%), Positives = 133/185 (71%), Gaps = 2/185 (1%) Frame = +3 Query: 12 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELH-NKKSIIIYVP 185 KI K AE E ++QAL +LE TN +LK++L++LYI +A +++ N+K+++IYVP Sbjct: 7 KIKKDKNAEPTECEEQVAQALFDLENTNQELKSELKDLYINQAVHMDISGNRKAVVIYVP 66 Query: 186 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 365 KAF+KI RLVRELEKKFSGK V+FV R+I+ P V +RPR+RTLTSV Sbjct: 67 FRLRKAFRKIHPRLVRELEKKFSGKDVIFVTTRRIMRPPKKGAAV----QRPRNRTLTSV 122 Query: 366 YNAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREV 545 + A+LED+ FPAEIVGKR R +LDGS+++KV LD ++ E+K++T VY+KLTG++V Sbjct: 123 HEAMLEDVAFPAEIVGKRTRYRLDGSKIMKVFLDAKEKNNTEYKLETMVGVYRKLTGKDV 182 Query: 546 TFEFP 560 FE+P Sbjct: 183 VFEYP 187 >At1g48830.2 68414.m05465 40S ribosomal protein S7 (RPS7A) similar to 40S ribosomal protein S7 homolog GI:5532505 from [Brassica oleracea] Length = 191 Score = 184 bits (449), Expect = 3e-47 Identities = 91/185 (49%), Positives = 133/185 (71%), Gaps = 2/185 (1%) Frame = +3 Query: 12 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELHN-KKSIIIYVP 185 KI K G E + ++QA +LE TN +LK++L++LY+ A ++++ +K+I++ VP Sbjct: 7 KIHKEKGVELSELDEQVAQAFFDLENTNQELKSELKDLYVNSAVQVDISGGRKAIVVNVP 66 Query: 186 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 365 KA++KI +RLVRELEKKFSGK V+ + R+I+ +P K A KRPR+RTLTSV Sbjct: 67 YRLRKAYRKIHVRLVRELEKKFSGKDVILIATRRIV-RPPKKGSAA---KRPRNRTLTSV 122 Query: 366 YNAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREV 545 + AIL+D+V PAEIVGKR R +LDG++++KV LD ++ E+KV+ F +VYKKLTG++V Sbjct: 123 HEAILDDVVLPAEIVGKRTRYRLDGTKIMKVFLDPKERNNTEYKVEAFSAVYKKLTGKDV 182 Query: 546 TFEFP 560 FEFP Sbjct: 183 VFEFP 187 >At1g48830.1 68414.m05464 40S ribosomal protein S7 (RPS7A) similar to 40S ribosomal protein S7 homolog GI:5532505 from [Brassica oleracea] Length = 191 Score = 184 bits (449), Expect = 3e-47 Identities = 91/185 (49%), Positives = 133/185 (71%), Gaps = 2/185 (1%) Frame = +3 Query: 12 KIIKASGAEADSFETSISQALVELE-TNSDLKAQLRELYITKAKEIELHN-KKSIIIYVP 185 KI K G E + ++QA +LE TN +LK++L++LY+ A ++++ +K+I++ VP Sbjct: 7 KIHKEKGVELSELDEQVAQAFFDLENTNQELKSELKDLYVNSAVQVDISGGRKAIVVNVP 66 Query: 186 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSV 365 KA++KI +RLVRELEKKFSGK V+ + R+I+ +P K A KRPR+RTLTSV Sbjct: 67 YRLRKAYRKIHVRLVRELEKKFSGKDVILIATRRIV-RPPKKGSAA---KRPRNRTLTSV 122 Query: 366 YNAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREV 545 + AIL+D+V PAEIVGKR R +LDG++++KV LD ++ E+KV+ F +VYKKLTG++V Sbjct: 123 HEAILDDVVLPAEIVGKRTRYRLDGTKIMKVFLDPKERNNTEYKVEAFSAVYKKLTGKDV 182 Query: 546 TFEFP 560 FEFP Sbjct: 183 VFEFP 187 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 28.7 bits (61), Expect = 3.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 326 QTKEATLKDIDLCVQCYPRGLG 391 Q +E++LK CV+CYP G G Sbjct: 179 QRRESSLKYQTRCVRCYPNGTG 200 >At1g59870.1 68414.m06745 ABC transporter family protein similar to PDR5-like ABC transporter GI:1514643 from [Spirodela polyrhiza] Length = 1469 Score = 28.7 bits (61), Expect = 3.2 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = +3 Query: 345 SRTLTSVYNAILEDLVFPAEIVGKRIRV-KLDG 440 SR T++ NA++ED V+ +++ K + V KLDG Sbjct: 65 SRLRTTLMNAVVEDDVYGNQLMSKEVDVTKLDG 97 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 28.7 bits (61), Expect = 3.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 326 QTKEATLKDIDLCVQCYPRGLG 391 Q +E++LK CV+CYP G G Sbjct: 178 QRRESSLKYQTRCVRCYPNGTG 199 >At1g52960.1 68414.m05990 hypothetical protein very low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 996 Score = 27.9 bits (59), Expect = 5.6 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 8/58 (13%) Frame = +3 Query: 147 ELHNKKSIIIY--VPMPKLKAFQKIQIRLVREL-----EKKFSGKHVVFVGD-RKILP 296 EL + ++II+ PM F+ + R +R++ +K F GK +VF GD R++LP Sbjct: 640 ELVKEANLIIWDETPMMSKHCFESLD-RTLRDIMNNPGDKPFGGKGIVFGGDFRQVLP 696 >At1g64590.1 68414.m07321 short-chain dehydrogenase/reductase (SDR) family protein contains INTERPRO family IPR002198 short-chain dehydrogenase/reductase (SDR) superfamily Length = 334 Score = 27.5 bits (58), Expect = 7.4 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 399 AEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSV 518 AE RI + +++I +HLD + T++ VD F+S+ Sbjct: 71 AEETKARILSEFPDAEIIVMHLDLSSLTSVRRFVDDFESL 110 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 27.5 bits (58), Expect = 7.4 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = -1 Query: 445 CEPSNLTLMRLPTISAGKTKSSRIALYTEVNVLE 344 C+ SN+T +R+P + G S +A ++ + V++ Sbjct: 66 CDSSNITEIRIPGMKVGGGLSDTLADFSSIQVMD 99 >At4g08113.1 68417.m01331 myosin heavy chain-related similar to Myosin heavy chain, skeletal muscle, extraocular (MyHC-eo) (SP:Q9UKX3) {Homo sapiens} Length = 764 Score = 27.1 bits (57), Expect = 9.7 Identities = 23/86 (26%), Positives = 34/86 (39%), Gaps = 3/86 (3%) Frame = +3 Query: 9 TKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEI---ELHNKKSIIIY 179 T +KA SF+ I + +EL T+ DL+ E EI EL K + Sbjct: 554 TSSVKAGQDRKVSFQAEIERLKMELSTSKDLEKGFAEKIGFMEMEIRGEELSKKVVDLTS 613 Query: 180 VPMPKLKAFQKIQIRLVRELEKKFSG 257 V + KA ++ L K +G Sbjct: 614 VAQGEKKAVHDAKVELAAAYSKLLAG 639 >At3g15800.1 68416.m02000 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 399 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 79 NSKPTPTSKPNFGSF 123 NSKP PTS+ NFG F Sbjct: 337 NSKPGPTSERNFGLF 351 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,647,653 Number of Sequences: 28952 Number of extensions: 258132 Number of successful extensions: 764 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -