BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0101 (448 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14144| Best HMM Match : MFS_1 (HMM E-Value=0.047) 27 5.3 SB_21494| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_14144| Best HMM Match : MFS_1 (HMM E-Value=0.047) Length = 355 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 124 IVAAVFYIFPQRISTG-LIAQRCTGNSFFFVGFVIPRA 14 + A Y + I++G LI T N FFF+GF+ P+A Sbjct: 281 MAAECTYPVAEGITSGVLILSVYTFNLFFFIGFMFPQA 318 >SB_21494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.1 bits (57), Expect = 7.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 110 HSRNYYTIHNWRFLRII 160 H R+YY NW FLR++ Sbjct: 86 HLRDYYDYINWAFLRVL 102 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,520,035 Number of Sequences: 59808 Number of extensions: 189455 Number of successful extensions: 405 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -