BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0096 (576 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80870.1 68414.m09489 protein kinase family protein contains ... 31 0.42 At3g53720.1 68416.m05934 cation/hydrogen exchanger, putative (CH... 27 9.0 At1g45160.1 68414.m05177 protein kinase family protein contains ... 27 9.0 >At1g80870.1 68414.m09489 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 692 Score = 31.5 bits (68), Expect = 0.42 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +3 Query: 408 KMMSMSSPLMEISIDGDTM--TIKNSSLLRTVEHKFKLGEEYEEKMPNSII 554 K MS++S M +++DG+T + N +L +H+F G+E PNS++ Sbjct: 289 KEMSLNS--MSLAMDGETKGKEVSNDVVLSCEDHEFDQGKEMNLLSPNSVL 337 >At3g53720.1 68416.m05934 cation/hydrogen exchanger, putative (CHX20) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 842 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +3 Query: 444 SIDGDTMTIKNSSLLRTVEHKFKLGEEYEEKMPNSIIKSVTTI 572 ++D + + L + K+K EY+EK PN+II+ + +I Sbjct: 715 NVDPEKEKELDEGALEDFKSKWKEMVEYKEKEPNNIIEEILSI 757 >At1g45160.1 68414.m05177 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 1067 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 489 RTVEHKFKLGEEYEEKMPN 545 + VE +F L +EYE+KM N Sbjct: 370 KVVEQRFYLSDEYEDKMSN 388 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,236,648 Number of Sequences: 28952 Number of extensions: 171212 Number of successful extensions: 265 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 265 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1121903184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -