BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0088 (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56597| Best HMM Match : COesterase (HMM E-Value=0) 31 0.86 SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) 29 4.6 >SB_56597| Best HMM Match : COesterase (HMM E-Value=0) Length = 505 Score = 31.1 bits (67), Expect = 0.86 Identities = 13/46 (28%), Positives = 28/46 (60%) Frame = +2 Query: 134 VLLMFIDYDIYILIVFLVFSVCEGSLGLSILVSIIRSHGNDYFQRF 271 ++++ I I I+I+ ++ + E + LSI+++II +DY Q + Sbjct: 453 IIIINIIIFIIIIIIIIIIIIIENVINLSIIINIIDVDVDDYLQAY 498 >SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) Length = 1420 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 101 IYCFKNFFFFLVLLMFIDYDIYILIVFLVFSVCEGSLGLSILVSI 235 +YC F LLM + I +++ F V + LGL L SI Sbjct: 1266 LYCIAAVFVVTFLLMGFNLSIALIVTFTVAMIITNLLGLMYLWSI 1310 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,798,991 Number of Sequences: 59808 Number of extensions: 77269 Number of successful extensions: 197 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 197 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -