BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0088 (682 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48185.1 68416.m05256 expressed protein 29 3.8 At3g56730.1 68416.m06310 expressed protein contains Pfam profile... 27 8.7 >At3g48185.1 68416.m05256 expressed protein Length = 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 92 EIRIYCFKNFFFFLVLLMFIDYDIYI-LIVFLVFSV 196 +I+ CF +FF F V F DY +Y L++F F + Sbjct: 36 QIKCVCFYSFFSFCVSFSF-DYPLYFYLLLFFFFRI 70 >At3g56730.1 68416.m06310 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 166 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +2 Query: 158 DIYILIVFLVFSVCEGSLGLSILVSIIRSHGNDYFQRFRIL 280 ++Y++ ++ +G L L + V I S D+F+ FR+L Sbjct: 83 EVYMIDLYSCVVKEDGPLNLMLFVGDISSRSKDFFRVFRLL 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,690,503 Number of Sequences: 28952 Number of extensions: 57815 Number of successful extensions: 191 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -