BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0075 (670 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 2.0 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 23 3.5 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 4.6 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 4.6 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 4.6 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 4.6 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.4 bits (48), Expect = 2.0 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +3 Query: 339 TRTAPRRPSKTT*KDLARTATATEWSTA-MTTWRSTRREA--TGAPAN 473 +RT P RPS T KD+ R + + WR EA TG+ N Sbjct: 281 SRTWPFRPSGTVLKDINRQVDELNFDIQDLERWRDRIYEAIHTGSVIN 328 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 209 LACIQR*PGKCSRD 168 LACI PG+C R+ Sbjct: 172 LACISSRPGQCGRE 185 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 164 VCLGCICQAISG 199 VCLG +CQ +G Sbjct: 8 VCLGIVCQGTTG 19 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -2 Query: 159 VTGGSSETSAKQTPATNSNAQT*SQPKPLRRKYTNKKILLKNDVYASLVPIP 4 + S +++ PA + A QP TNK+ L + SL+P+P Sbjct: 517 IASAPSSSTSSSPPAKGAAAA--GQPSKRNGGETNKQELKRLKSTVSLLPLP 566 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 164 VCLGCICQAISG 199 VCLG +CQ +G Sbjct: 8 VCLGIVCQGTTG 19 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 164 VCLGCICQAISG 199 VCLG +CQ +G Sbjct: 8 VCLGIVCQGTTG 19 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,864 Number of Sequences: 438 Number of extensions: 4730 Number of successful extensions: 21 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -