BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0071 (706 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5UQD2 Cluster: Putative bifunctional polynucleotide ph... 33 6.8 >UniRef50_Q5UQD2 Cluster: Putative bifunctional polynucleotide phosphatase/kinase (Polynucleotide kinase-3'-phosphatase) (DNA 5'-kinase/3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')- polynucleotidase); Polynucleotide 5'-hydroxyl-kinase (EC 2.7.1.78)]; n=1; Acanthamoeba polyphaga mimivirus|Rep: Putative bifunctional polynucleotide phosphatase/kinase (Polynucleotide kinase-3'-phosphatase) (DNA 5'-kinase/3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')- polynucleotidase); Polynucleotide 5'-hydroxyl-kinase (EC 2.7.1.78)] - Mimivirus Length = 421 Score = 33.1 bits (72), Expect = 6.8 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 4/96 (4%) Frame = -2 Query: 693 IQPSVDYSTTYKYSKF*DVTTS----TLRVPIKFMTSLKNHP*LSTSCTVPFALNPQ*HS 526 I PS+ Y SK D + + L + IKF+T + + L + + N + Sbjct: 176 IYPSMFKKKLYPTSKGGDFSDTDRKFALNIGIKFLTPEEFY--LDSKNSENLKTN---YK 230 Query: 525 RQGKNVINIVFRIDNAKSINFKIKPALKKTLILFGK 418 G N I+ I+N K +N+K KP K+ +++ G+ Sbjct: 231 LSGVNPTEIIDEIENTKLVNYKFKPRKKEMIVMIGQ 266 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 586,445,448 Number of Sequences: 1657284 Number of extensions: 10342498 Number of successful extensions: 17648 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 17247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17646 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56198352344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -