BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0071 (706 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 4.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.6 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 332 RVINMQILNIRIQFNYE*HYPTIFITASEGFN 237 RVIN LN I+ + + H ++ T FN Sbjct: 283 RVINAGFLNCPIEVSIDNHTLSVISTDGSDFN 314 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 5.6 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = -3 Query: 329 VINMQILNIRIQFNYE*HYPTIFITASEGFNGAVNKYAI 213 + ++QILN R +FN +P + F ++ I Sbjct: 1061 MFSLQILNERAEFNAAGFFPIDYTLVFSKFTSSIRMLLI 1099 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,373 Number of Sequences: 336 Number of extensions: 3084 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -