BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0067 (591 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|... 26 3.6 SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo... 25 6.2 SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe... 25 6.2 SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3||... 25 8.3 >SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr 2|||Manual Length = 446 Score = 26.2 bits (55), Expect = 3.6 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 Query: 199 MRNGYCSSQLGSRLFSRQCYAHG 131 ++ G C +Q+GS+ + + C HG Sbjct: 8 LQAGQCGNQIGSQFWQQLCLEHG 30 >SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 25.4 bits (53), Expect = 6.2 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 147 CRLN-SLEPNWELQYPFLMISLKLQVNLKKTQQQF 248 CRLN S +PN ++ + ++ L + ++KK +Q F Sbjct: 190 CRLNHSCDPNCQIIFDGAIVQLVSKRDIKKDEQLF 224 >SPAC30D11.06c |||DUF300 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 25.4 bits (53), Expect = 6.2 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +3 Query: 60 CLFLLKISFISK*RSWRSSVY*NLPCA*HCRLNSLEPNWELQYPFLMISLK 212 C F L I ++ R+ S++ +LP LN L+ + +L P+ +S+K Sbjct: 81 CFFCLLIDYLGGERAAVISLHGHLPRPRLWPLNYLQDDIDLSDPYTFLSIK 131 >SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 465 Score = 25.0 bits (52), Expect = 8.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 339 VASVTFSASGFTFLSSVLVSTAEVVFCF 256 +A F +GFTF+ +L+ T CF Sbjct: 109 MALYCFRWTGFTFIEGILICTGLTGLCF 136 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,893,295 Number of Sequences: 5004 Number of extensions: 30536 Number of successful extensions: 70 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -