BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0067 (591 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical p... 27 7.5 AF101318-2|AAK68599.1| 331|Caenorhabditis elegans Seven tm rece... 27 10.0 >Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical protein T10C6.4 protein. Length = 294 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 247 NCCCVFFRFTWSLRDIMRNGYCSSQL 170 NC FF+F W + RN C ++L Sbjct: 136 NCSFPFFQFGWVFMEAQRNETCGAKL 161 >AF101318-2|AAK68599.1| 331|Caenorhabditis elegans Seven tm receptor protein 66 protein. Length = 331 Score = 27.1 bits (57), Expect = 10.0 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 195 LMISLKLQVNLKKTQQQFSLRNKTQLLQ*ILRLMI 299 + SLK+ N+KK ++FS++N+ Q + L+I Sbjct: 214 IFCSLKMHFNMKKELEKFSVQNQNLQRQYFIALVI 248 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,638,490 Number of Sequences: 27780 Number of extensions: 180110 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1247656244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -