BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0067 (591 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.0 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 9.0 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/24 (41%), Positives = 11/24 (45%), Gaps = 2/24 (8%) Frame = +2 Query: 188 PVPHDIPQAP--GKPEENATAVQP 253 P PH PQAP G P + P Sbjct: 25 PSPHQSPQAPQRGSPPNPSQGPPP 48 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.0 bits (42), Expect = 9.0 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 193 NGYCSSQLGSRLFSRQCYAHGKFQ*TDERQDLHFEIKLIFNKNKQLNK 50 NG+ +Q SR R A + R +LH + K + LNK Sbjct: 248 NGFTVAQTISRNGVRLSSARAFITPFENRSNLHVIVNATVTKVRTLNK 295 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,466 Number of Sequences: 438 Number of extensions: 1768 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -