BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0066 (585 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 5.5 EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 23 7.3 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.4 bits (48), Expect = 5.5 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +1 Query: 256 KSIRYTRNEALCCDQTPTSDSLQAKSSKPCVSL*NDNIRNE 378 K++RY + L C + L + CV+L D + ++ Sbjct: 622 KALRYIFGKTLICRNLERATELAKSTGLDCVTLEGDQVSSK 662 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 23.0 bits (47), Expect = 7.3 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +2 Query: 329 NLVNHVLACETIISEMSNRFENLKLTETEMLNNRNKKTNYNFLDENFGTEIHIYNSLR 502 N + H++ C + N LK E L+NR +L E+ T + + +L+ Sbjct: 92 NNIKHIIVCGHSDCKAMNLLYKLKDPEFASLDNRRISPLRAWLCEHANTSLAKFQNLK 149 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 513,988 Number of Sequences: 2352 Number of extensions: 9203 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -