BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0056 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0812 + 23383704-23384143,23384902-23385247 247 4e-66 06_01_0026 + 265755-265968,267319-267468,267694-267738,267786-26... 29 1.7 01_07_0112 - 41149461-41151674,41151688-41153265,41154344-411555... 29 2.9 04_01_0618 - 8094991-8097288 28 5.1 11_06_0377 - 22900042-22900452,22900527-22902236 27 6.8 >12_02_0812 + 23383704-23384143,23384902-23385247 Length = 261 Score = 247 bits (605), Expect = 4e-66 Identities = 109/160 (68%), Positives = 135/160 (84%) Frame = +3 Query: 36 MGRVIRAQRKGAGSVFVSHTKKRKGAPKLRSLDYAERHGYIKGVVKDIIHDPGRGAPLAV 215 MGRVIRAQRKGAGSVF SHT RKG + RSLD+ ER+GY+KGVV DIIHDPGRGAPLA Sbjct: 1 MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK 60 Query: 216 VHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKM 395 V FR P+++K +KELF+A EG+YTGQFVYCG++ATL +GNV+P+ ++PEG +VCN+E + Sbjct: 61 VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLPIRSVPEGAVVCNVEHHV 120 Query: 396 GDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPS 515 GDRG ARASG++A VI HNPD +R+KLPSGAKK++PS Sbjct: 121 GDRGVFARASGDYAIVISHNPDNGTSRIKLPSGAKKIVPS 160 >06_01_0026 + 265755-265968,267319-267468,267694-267738,267786-268460, 268779-268843,268854-269073,269163-269438,269547-269663, 269776-269853,269930-270184,270235-270323,270403-270816 Length = 865 Score = 29.5 bits (63), Expect = 1.7 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 422 LWKLRHCDWT 451 LWK RHCDWT Sbjct: 73 LWKCRHCDWT 82 >01_07_0112 - 41149461-41151674,41151688-41153265,41154344-41155507, 41155807-41156293,41156603-41156759,41157303-41157378 Length = 1891 Score = 28.7 bits (61), Expect = 2.9 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 453 CVQSQWRSFQRHVPDDLYHPFSLQDCTQWY 364 C W++ H+P L H + +C WY Sbjct: 73 CSCGLWKATTHHLPSALCHGLNYVNCAMWY 102 >04_01_0618 - 8094991-8097288 Length = 765 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 227 RSIQVQDKEGALHCSRRALHRPICLLW 307 R Q+ D++ + C+ R +P CLLW Sbjct: 434 RRNQMVDQQSVIWCAARMTKKPNCLLW 460 >11_06_0377 - 22900042-22900452,22900527-22902236 Length = 706 Score = 27.5 bits (58), Expect = 6.8 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +3 Query: 315 ATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRL-ARASGNFATVIGHNPDAKRTRVK 482 A L+ G P+G + E VC L + D R+ A +G + G PD + RV+ Sbjct: 373 AALDDGEERPLGGLVEELFVCRLGD--DDEVRVGANHNGEGRRLRGPRPDGEEARVR 427 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,911,587 Number of Sequences: 37544 Number of extensions: 319970 Number of successful extensions: 815 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -