BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0043 (671 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z95559-4|CAB09004.1| 110|Caenorhabditis elegans Hypothetical pr... 28 6.9 AF016446-9|AAC24169.2| 340|Caenorhabditis elegans Hypothetical ... 27 9.2 >Z95559-4|CAB09004.1| 110|Caenorhabditis elegans Hypothetical protein Y41E3.8 protein. Length = 110 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = +1 Query: 124 MVYVTGDGTIVEKTPFSFMGWFWALLNFFSLLFHTLIDSNYNKHGKKYTRDFR 282 MVY+ DG ++EK + F L F +L+ + ++D+R Sbjct: 1 MVYIDKDGNVLEKKQKGIVEMIVGFFTFIMLFFRSLLGFTSPTNRNSNSQDYR 53 >AF016446-9|AAC24169.2| 340|Caenorhabditis elegans Hypothetical protein C02E7.10 protein. Length = 340 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -3 Query: 351 PRARWTKAPK--LFGWWFRRPTSWWSEIPCVFFAMFIIVRI 235 PRA+ T P +F W +RPT++ + C F +++ + Sbjct: 56 PRAQTTNLPSESVFVWPAQRPTNYIRQDSCQFIGYVLVIAV 96 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,080,018 Number of Sequences: 27780 Number of extensions: 239213 Number of successful extensions: 537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -