BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0042 (631 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 29 0.042 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 26 0.23 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 8.5 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 28.7 bits (61), Expect = 0.042 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 185 SNNAFRFEGWGSRCSYTEILELISRGGWRI 274 + N+ ++ G Y EI+EL GGW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 26.2 bits (55), Expect = 0.23 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 125 IYIQSTTLVN-SNLR*LEPLYSN-NAFRFEGWGSRCSYTEILELISRGGW 268 +Y +S TL + SN + P+ + +A R+ G Y EI+E + GGW Sbjct: 266 VYGRSFTLASASNNKLGAPIVAGGDAGRYTGERGMMGYNEIVEAQNAGGW 315 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.0 bits (42), Expect = 8.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 151 NESRRLYIYIFLDIKS 104 N S+R YIY +LD K+ Sbjct: 458 NLSKRPYIYKYLDKKN 473 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,466 Number of Sequences: 336 Number of extensions: 3210 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -