BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0041 (712 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC409.09c |mis13|cnl1|kinetochore protein Mis13|Schizosaccharo... 26 4.6 SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase Ubp16|Schizo... 26 6.1 SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual 25 8.1 >SPBC409.09c |mis13|cnl1|kinetochore protein Mis13|Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 26.2 bits (55), Expect = 4.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 65 QFHDLLALLTMNFHSLHS 12 +FH LL +L N H+LHS Sbjct: 256 KFHTLLDMLAENIHTLHS 273 >SPCC1682.12c |ubp16||ubiquitin C-terminal hydrolase Ubp16|Schizosaccharomyces pombe|chr 3|||Manual Length = 457 Score = 25.8 bits (54), Expect = 6.1 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +3 Query: 195 NRSRVVVAVYFMGYCHQNS*CSLCGRIRVHYEFCFETCVGTTGGSAA 335 +R VV F GY Q CS+C + Y+ + V G S A Sbjct: 241 SRETSVVHRIFGGYLRQQILCSVCKKPSNTYQALLDLSVDAKGSSLA 287 >SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 1496 Score = 25.4 bits (53), Expect = 8.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 513 YGSHGRYCVWQQRRRRS 463 Y HG CVWQ R +++ Sbjct: 247 YSHHGPMCVWQPRSQKN 263 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,823,828 Number of Sequences: 5004 Number of extensions: 55154 Number of successful extensions: 119 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -