BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0036 (443 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 6.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 6.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 6.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 6.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 6.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 6.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 6.9 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 20 9.2 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 20 9.2 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.6 bits (41), Expect = 6.9 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCAS 239 PR + P S SSG ++ ST PG AT AS Sbjct: 123 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTAS 163 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 20.6 bits (41), Expect = 6.9 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCAS 239 PR + P S SSG ++ ST PG AT AS Sbjct: 123 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTAS 163 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.6 bits (41), Expect = 6.9 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCAS 239 PR + P S SSG ++ ST PG AT AS Sbjct: 123 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTAS 163 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 20.6 bits (41), Expect = 6.9 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCAS 239 PR + P S SSG ++ ST PG AT AS Sbjct: 123 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTAS 163 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 20.6 bits (41), Expect = 6.9 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCAS 239 PR + P S SSG ++ ST PG AT AS Sbjct: 79 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTAS 119 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 20.6 bits (41), Expect = 6.9 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCAS 239 PR + P S SSG ++ ST PG AT AS Sbjct: 123 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTAS 163 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 20.6 bits (41), Expect = 6.9 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG--ATLCAS 239 PR + P S SSG ++ ST PG AT AS Sbjct: 123 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTAS 163 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 20.2 bits (40), Expect = 9.2 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG 257 PR + P S SSG ++ ST PG Sbjct: 123 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 20.2 bits (40), Expect = 9.2 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -2 Query: 355 PRMSSPCRACSKYPRKVSSGSLPAITTSTLSPG 257 PR + P S SSG ++ ST PG Sbjct: 123 PRSTPPLSTPSNSNATKSSGLTSPLSVSTSPPG 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,021 Number of Sequences: 336 Number of extensions: 1280 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9985735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -