BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0034 (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.6 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 4.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 8.5 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.5 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 104 PSNL*MKGNIR*CFTCSAINTTYKSYSLNRL 196 PSN+ N+ FT A NT + Y+LN + Sbjct: 564 PSNIEESNNMTDSFTRIANNTIQELYTLNNM 594 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 393 LHRRKLEIHNGTNEETSRA 449 +HR + +HNG+N + R+ Sbjct: 307 IHRGRGSVHNGSNNGSPRS 325 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 396 HRRKLEIHNGTNEETSRALAKVSATLHGLRSRS 494 HR L ++ +E ++ K + + + LRSRS Sbjct: 189 HRTVLAVNIEKSENETKTCKKYAISSNSLRSRS 221 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 396 HRRKLEIHNGTNEETSRALAKVSATLHGLRSRS 494 HR L ++ +E ++ K + + + LRSRS Sbjct: 189 HRTVLAVNIEKSENETKTCKKYAISSNSLRSRS 221 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 396 HRRKLEIHNGTNEETSRALAKVSATLHGLRSRS 494 HR L ++ +E ++ K + + + LRSRS Sbjct: 189 HRTVLAVNIEKSENETKTCKKYAISSNSLRSRS 221 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 396 HRRKLEIHNGTNEETSRALAKVSATLHGLRSRS 494 HR L ++ +E ++ K + + + LRSRS Sbjct: 189 HRTVLAVNIEKSENETKTCKKYAISSNSLRSRS 221 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 396 HRRKLEIHNGTNEETSRALAKVSATLHGLRSRS 494 HR L ++ +E ++ K + + + LRSRS Sbjct: 189 HRTVLAVNIEKSENETKTCKKYAISSNSLRSRS 221 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 396 HRRKLEIHNGTNEETSRALAKVSATLHGLRSRS 494 HR L ++ +E ++ K + + + LRSRS Sbjct: 189 HRTVLAVNIEKSENETKTCKKYAISSNSLRSRS 221 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 396 HRRKLEIHNGTNEETSRALAKVSATLHGLRSRS 494 HR L ++ +E ++ K + + + LRSRS Sbjct: 189 HRTVLAVNIEKSENETKTCKKYAISSNSLRSRS 221 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,504 Number of Sequences: 438 Number of extensions: 4346 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -