BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0033 (678 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41037-1|AAA82387.1| 629|Caenorhabditis elegans Gtpase activati... 29 4.0 AF118123-1|AAD13781.1| 629|Caenorhabditis elegans GTPase activa... 29 4.0 Z92782-12|CAH60765.1| 328|Caenorhabditis elegans Hypothetical p... 28 5.3 AF039050-4|AAC47937.1| 499|Caenorhabditis elegans Cytochrome p4... 28 5.3 Z92782-9|CAE17814.1| 329|Caenorhabditis elegans Hypothetical pr... 27 9.3 >U41037-1|AAA82387.1| 629|Caenorhabditis elegans Gtpase activating protein familyprotein 1 protein. Length = 629 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 235 LIKILRMFFRDLQSTVKSFFYGQIRVR-DANAHTHPHNWQHIR 110 ++ + ++DL + S F+GQ+RV D N + P W ++R Sbjct: 58 MLSLKLTLWQDLLKGINSVFHGQVRVDVDENWKSGPAKWFYLR 100 >AF118123-1|AAD13781.1| 629|Caenorhabditis elegans GTPase activating protein GAP-1 protein. Length = 629 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 235 LIKILRMFFRDLQSTVKSFFYGQIRVR-DANAHTHPHNWQHIR 110 ++ + ++DL + S F+GQ+RV D N + P W ++R Sbjct: 58 MLSLKLTLWQDLLKGINSVFHGQVRVDVDENWKSGPAKWFYLR 100 >Z92782-12|CAH60765.1| 328|Caenorhabditis elegans Hypothetical protein F14F8.13 protein. Length = 328 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -3 Query: 253 TQFVFVLIKILRMFFRDLQSTVKSFFYGQIRVRDANAHTHPHNWQHIRLR 104 ++F V IL F + S + F Y I + D N + H H+ QHI L+ Sbjct: 183 SEFCIVCYIILFAFLNFVISVLTPFIYIPIMI-DINKNQHLHSQQHIYLQ 231 >AF039050-4|AAC47937.1| 499|Caenorhabditis elegans Cytochrome p450 family protein 34A7 protein. Length = 499 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 44 FGGKKTGCVTFRKQYHRLYYTQTDMLPIVRVC 139 +GG G FRKQY +++ +P V++C Sbjct: 48 YGGLVAGFDQFRKQYGKVFTVWMGPIPAVQIC 79 >Z92782-9|CAE17814.1| 329|Caenorhabditis elegans Hypothetical protein F14F8.12 protein. Length = 329 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -3 Query: 244 VFVLIKILRMFFRDLQSTVKSFFYGQIRVRDANAHTHPHNWQHIRLR 104 +F I +FF + S + F Y I + D N + H H+ QHI L+ Sbjct: 155 IFECFIISFVFFNFVISVLTPFIYIPIMI-DINKNQHLHSQQHIYLQ 200 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,044,721 Number of Sequences: 27780 Number of extensions: 316694 Number of successful extensions: 694 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -