BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0033 (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 4.7 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 53 KKTGCVTFRKQYHRLYYTQTDMLPIVRVC 139 KK C +RK Y+ + Y + +P+ C Sbjct: 97 KKLYCNNYRKLYYNINYIEQIPIPVPIYC 125 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -2 Query: 617 QNTKKKI--TFHLFVIS*VFCLYFFNGKTMLSLGQNASERNFDFFSY 483 +N +K I TFHL V+ L+ N ++++ + + + FD +Y Sbjct: 135 RNHRKLIAPTFHLNVLKSFIDLFNANARSVVEKMRKENGKEFDCHNY 181 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,339 Number of Sequences: 438 Number of extensions: 3903 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -