BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0031 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 24 5.5 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 7.3 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 383 NYSCCRF*ILFAFCAKFSRNEQYCIGLGVFFDIYF 487 N +C F + AFC S N C+ L F + + Sbjct: 147 NVACKVFLFMRAFCLYLSSNVLVCVSLDRCFAVIY 181 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.4 bits (48), Expect = 7.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 471 FLTSIFQPLDIVLYYHKTKK 530 F IF+ L I+ YYH K+ Sbjct: 382 FFPMIFEALGIIEYYHPRKQ 401 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,765 Number of Sequences: 2352 Number of extensions: 13629 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -