BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0030 (588 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 101 5e-24 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.55 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 24 1.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.8 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 101 bits (242), Expect = 5e-24 Identities = 51/124 (41%), Positives = 73/124 (58%), Gaps = 4/124 (3%) Frame = +3 Query: 54 TVAVAAPQSPT----EPIPILKQESSIEPDGSYQYSYETGNGISAAERGALKNIGAEEPA 221 T +AAPQ P+ + I Q+ + DG+Y ++ET NGIS E G K + E P Sbjct: 10 TATLAAPQRPSGGADKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQVDNETPV 69 Query: 222 LQVEGQFQYPSEDGGTIQLSYIANENGFQPQGSHLPTPPPIPEVIQRALAYLATAPPQPE 401 + +G Y + DG + ++Y+A+ENGFQ QGSH+PT PPIP IQRAL + A P + + Sbjct: 70 VS-QGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTAPPIPPEIQRALEWNAAHPEEDD 128 Query: 402 NNRP 413 +P Sbjct: 129 GGQP 132 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.0 bits (52), Expect = 0.55 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 241 SSTQARTVVLSSCPTSPMRTASSLRDHIYP 330 +S+ A T+VLS CP++ M + D P Sbjct: 845 ASSTAATLVLSGCPSNMMELQVDIADSQQP 874 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.8 bits (49), Expect = 1.3 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 48 LVTVAVAAPQ--SPTEPIPILKQESSIEPDGSYQYS 149 +VTVA++ + E +P +S+EPD YS Sbjct: 66 VVTVAISTGEWLLTEEKLPKTSSNASVEPDSKVTYS 101 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 288 ANENGFQPQGSHLPTPPPIPEVIQ 359 AN N +QP +P PP V Q Sbjct: 752 ANVNLWQPLSVSIPPPPSAQNVPQ 775 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,208 Number of Sequences: 438 Number of extensions: 3839 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -