BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0028 (518 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 2.1 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 2.8 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 2.8 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 2.8 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 6.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.7 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.6 bits (46), Expect = 2.1 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 Query: 278 NWRSVPRQTISVCACAQD 331 NW S P T+ AC D Sbjct: 19 NWSSGPNATLQSSACTDD 36 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.2 bits (45), Expect = 2.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 310 RNSLPRHRSPISRIPSQGTL 251 R +LP HR P IP G + Sbjct: 374 RTNLPTHRHPQDEIPYCGKI 393 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 2.8 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 451 TRHQFYLHAKLDLTEGRLVVAD 516 T+H+ +L T+GRLV+ + Sbjct: 203 TKHRLTGETRLSATKGRLVITE 224 Score = 21.0 bits (42), Expect = 6.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 352 NLRNPLDPHRIPGGRLDLRVKFWVPPHLLINE 447 NLRN H+ +L+ +FWV I E Sbjct: 1259 NLRNQNLSHQAKNLDSNLKYEFWVTAATTIGE 1290 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 22.2 bits (45), Expect = 2.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 15 KEYAINISQSELRRTFLNKYLRV*DKQL 98 +E+A N+ S LRR + LR+ +KQ+ Sbjct: 134 REFASNMYLSRLRRIEIATCLRLSEKQV 161 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.0 bits (42), Expect = 6.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 449 GSLMSR*GGTQNLTRRSSRPP 387 GSL+S G T N + S PP Sbjct: 55 GSLLSPSGNTPNKSSTSPYPP 75 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/29 (27%), Positives = 13/29 (44%) Frame = +1 Query: 250 QECLEKVCEKLEIGAEADYFGLRVCPGSG 336 ++CL K+ + + FG CP G Sbjct: 142 RKCLYKLWKMPSLSEFLSLFGTETCPAIG 170 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/29 (27%), Positives = 13/29 (44%) Frame = +1 Query: 250 QECLEKVCEKLEIGAEADYFGLRVCPGSG 336 ++CL K+ + + FG CP G Sbjct: 142 RKCLYKLWKMPSLSEFLSLFGTETCPAIG 170 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,161 Number of Sequences: 336 Number of extensions: 2703 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12468463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -