BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0028 (518 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 29 0.55 SPBC354.10 |||RNAPII degradation factor |Schizosaccharomyces pom... 27 2.2 SPCC23B6.01c |||oxysterol binding protein |Schizosaccharomyces p... 25 5.1 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 28.7 bits (61), Expect = 0.55 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = -3 Query: 186 HFGQHFE--RKYVKFNKSGRKIFSLMNLTHVTIV----YLTRANIYLKKSFLIRSVKCLS 25 + G + E R + K G +FS + V + Y R + +L KS++ R++ CL Sbjct: 1275 NLGNYMEALRLFEKVTSMGASVFSPIEFPFVLELIGEFYYGRGHKFLAKSYITRALSCLK 1334 Query: 24 RILC 13 I C Sbjct: 1335 NIGC 1338 >SPBC354.10 |||RNAPII degradation factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 963 Score = 26.6 bits (56), Expect = 2.2 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 419 QNLTRRSSRPPGMRCGSRGFRKLSHLPGPDPGHTRRP 309 +N TR+S +P + SRG RK DP P Sbjct: 153 RNATRKSKKPSASKDTSRGVRKSKAGAPSDPSSVHAP 189 >SPCC23B6.01c |||oxysterol binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 489 Score = 25.4 bits (53), Expect = 5.1 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -3 Query: 447 FVDEQVRGHPELDAEV*PSSGYAVRIEGVPQVKPSS 340 + EQV HP + A Y VRI+GV VKP S Sbjct: 141 YAAEQVCHHPPISAYFYLCPEYKVRIDGV--VKPRS 174 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,172,417 Number of Sequences: 5004 Number of extensions: 45055 Number of successful extensions: 123 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 210309424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -