BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0020 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) 232 2e-61 SB_36524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.055 SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) 34 0.13 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 29 2.7 SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) 29 3.6 SB_28863| Best HMM Match : EzrA (HMM E-Value=1.1) 29 4.8 SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) 29 4.8 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 28 6.3 SB_33399| Best HMM Match : Ank (HMM E-Value=0) 28 6.3 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 6.3 SB_27097| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_19577| Best HMM Match : SERTA (HMM E-Value=7.8e-10) 28 8.3 >SB_15432| Best HMM Match : Ribosomal_L10 (HMM E-Value=3.1e-37) Length = 261 Score = 232 bits (567), Expect = 2e-61 Identities = 108/151 (71%), Positives = 128/151 (84%) Frame = +3 Query: 117 QLLDEYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAIKDHLDNNPALEKL 296 Q LDEYPK F+VG DNVGS+QMQ IR SLRG VLMGKNTM+RKAI+ HL+NNP LEKL Sbjct: 1 QYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQGEVLMGKNTMIRKAIRGHLENNPDLEKL 60 Query: 297 LPHIKGNVGFVFTRGDLVEVRDKLLENKVQAPARPGAIAPLSVVIPAHNTGLGPEKTSFF 476 LPHIKGN+GFVFT+ DL +VR ++ENKV APA+ G IAP+ V +PA NTGLGPEKTSFF Sbjct: 61 LPHIKGNIGFVFTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNTGLGPEKTSFF 120 Query: 477 QALSIPTKISKGTIEIINDVHILKPGDKVGA 569 QAL+IPTKI++GTIEIINDVH++K +K+ A Sbjct: 121 QALAIPTKIARGTIEIINDVHLIKKDEKLKA 151 >SB_36524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 35.1 bits (77), Expect = 0.055 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +3 Query: 231 KNTMMRKAIKDHLDNNPALEKLLPHIKGNVGFVFTRGDL 347 K T++RK +K HLDN P L K LP + G + + + GDL Sbjct: 168 KVTIVRKELKSHLDNLPDLSK-LPDVDGGLAPLPSAGDL 205 >SB_46306| Best HMM Match : 6PGD (HMM E-Value=0) Length = 870 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = -2 Query: 533 IVDDFNSTL*NLGRDRKSLEERGLLWTEAGVVGGNDD*QWG 411 I+D NS + R K+LEERGLL+ +GV GG + ++G Sbjct: 144 IIDGGNSEYKDSMRRCKALEERGLLFVGSGVSGGEEGARYG 184 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = +3 Query: 372 ENKVQAPARPGAIAPLSVVIPAHN--TGLGPEKTSFFQALSIPTKISKGTIEIINDVHIL 545 E ++ +PA +P S+ TGL P S Q LS+ T + ++ D+ Sbjct: 2069 EPRIVSPAGSSLASPTSIATSVITGVTGLHPVTVSHHQPLSVITSLVSASVSSTTDMQNS 2128 Query: 546 KPGDK 560 PG K Sbjct: 2129 TPGKK 2133 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/106 (20%), Positives = 41/106 (38%), Gaps = 5/106 (4%) Frame = +1 Query: 148 SWVPITWARNRCSRSVSRYVAPVSCSWEKTQ*C-AKPSKTTWTTIQPSRNCCHTSRATLA 324 S VP+T + + + P + + + T KP + + CC+ +A A Sbjct: 580 SSVPLTQFQAQLQQQQPAQATPTNAATQDTDSAPCKPICLKFCVTLCPQKCCNKGKAAAA 639 Query: 325 SCSPAETSLRSVTNCWRTKSKLQLVLVPLPHCQSSFP----PTTPA 450 + +P + + T T++ + P P C P P+ PA Sbjct: 640 AAAPTKPPTAAPTTAAATQAAPAAMTCPQPACAPQSPMSCMPSCPA 685 >SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) Length = 672 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 439 WAGMTTDNGAMAPGRAGAWTLFSNSL 362 W+ T D PGRA AW+L+S +L Sbjct: 594 WSIATLDGKDQPPGRAWAWSLWSTTL 619 >SB_28863| Best HMM Match : EzrA (HMM E-Value=1.1) Length = 939 Score = 28.7 bits (61), Expect = 4.8 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = -3 Query: 670 ISGAKIVPESYTCLTTRPYENGEMFNMLRRVASEAPTLSPGFKMCTSL--MISIVPFEIL 497 +S + +VP+SY TRP NG+ + + A E P+L+ F+ L +I + I Sbjct: 162 LSVSNLVPDSYFDAFTRPIINGK---VEEKTAGEGPSLATMFEDDRHLQGVIQSIRDAIS 218 Query: 496 VGIERAWK 473 + AWK Sbjct: 219 NAFDMAWK 226 >SB_17157| Best HMM Match : Kinesin (HMM E-Value=0.59) Length = 2053 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 565 PTLSPGFKMCTSLMISIVPFEILVGIERAWKKEVFSGPR 449 P P F+ C +L+ ++ ++ + RAW+KEV S R Sbjct: 1843 PRNVPNFRACCALVSALSGYQYM---RRAWRKEVISSQR 1878 >SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4527 Score = 28.3 bits (60), Expect = 6.3 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = +3 Query: 459 EKTSFFQALSIP---TKISKGTIEIINDVHILKPGDKVGASEATLLNMLNISPFSY-GLV 626 E S Q+ + P T++S G+ + V +KP + G + T ++ N+S S Sbjct: 2269 EPVSIMQSQNTPPVETELSAGSRTSLPKVSAIKPSVEYGQLDDTEIHETNLSASSIPSEK 2328 Query: 627 VKQVYDSGTIFAPEILDI 680 VK ++ S T+ P L I Sbjct: 2329 VKSLFMSSTLDTPSSLSI 2346 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -3 Query: 376 FSNSLSRTSTRSPRVNTKPTLPLMCGNSFSRAGLLSR 266 FS+S + T KP +CG SFS++G LSR Sbjct: 464 FSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSR 500 >SB_33399| Best HMM Match : Ank (HMM E-Value=0) Length = 1416 Score = 28.3 bits (60), Expect = 6.3 Identities = 28/107 (26%), Positives = 41/107 (38%), Gaps = 10/107 (9%) Frame = -3 Query: 691 SSGLMSRISGAKIVPESY-TCLTTRPYENGEMFNMLRRVASEAPTLSP---GFKMCTSLM 524 S L GA P + T T+ PY + AS +PT+SP C+++ Sbjct: 1201 SQPLFITTPGALFTPLPHETSATSPPYTSASPVPTTTPSASSSPTISPIGSSLAQCSTVD 1260 Query: 523 ISIVPFEILVGIERAWKKEVFS------GPRPVLWAGMTTDNGAMAP 401 P +G ERA ++ S G P++ G NG P Sbjct: 1261 SMDKPSLRPIGTERACRRATASPLPSMPGISPLIGGGKLVGNGDSVP 1307 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 131 VPKMFHRGCR*RGLATDAADPYLAT-WLQYRAHGKK 235 VPKMFH RG+ T+A P + T +L+ R G++ Sbjct: 3856 VPKMFHGNRDNRGIKTNAIFPTIITRYLRIRPMGRR 3891 >SB_27097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +1 Query: 604 LHSHMVLLLSRYMILELFLHLKFWTSNQKIS 696 L S +++++ RY+ + LH + W S +K+S Sbjct: 145 LLSMLLMMVDRYIAIAWGLHYRIWKSQRKVS 175 >SB_19577| Best HMM Match : SERTA (HMM E-Value=7.8e-10) Length = 543 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/50 (40%), Positives = 23/50 (46%) Frame = -3 Query: 574 SEAPTLSPGFKMCTSLMISIVPFEILVGIERAWKKEVFSGPRPVLWAGMT 425 S P L P S I+P EILVG+ER +K V G L MT Sbjct: 258 SNGPPLEPKVWDLESAEWPIIPGEILVGLER--RKPVLKGLLITLCENMT 305 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,377,359 Number of Sequences: 59808 Number of extensions: 549218 Number of successful extensions: 1509 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1507 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -