BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0019 (517 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1682 - 39130696-39131705,39132355-39132583 33 0.10 06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 31 0.42 07_01_0231 - 1698244-1700154 31 0.73 02_05_0218 + 26860319-26862448 31 0.73 11_06_0610 - 25449085-25453284 30 0.96 02_04_0122 - 19959137-19960043,19960150-19960714,19960932-19961202 30 0.96 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 30 1.3 09_02_0223 + 5977138-5977459,5979842-5980842 30 1.3 02_05_0380 + 28472494-28473090 30 1.3 01_03_0117 + 12684729-12685886,12685978-12686145,12686292-126863... 29 1.7 11_01_0620 - 4964263-4965052,4965578-4965663,4966332-4966413,496... 29 2.2 07_03_1160 - 24430240-24431268 29 2.2 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 2.9 05_03_0088 - 8308587-8308649,8308682-8308738,8310403-8310501,831... 29 2.9 03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114,446... 29 2.9 02_05_0591 - 30183105-30183869 29 2.9 02_04_0381 - 22497519-22497769,22498157-22498247 29 2.9 11_01_0727 - 6010537-6010548,6011029-6011606,6011709-6011774,601... 28 3.9 02_01_0302 - 2021221-2023305 28 3.9 08_02_1256 + 25645085-25645396 28 5.1 07_03_0471 + 18501496-18502104,18503009-18503260,18503367-185035... 28 5.1 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 27 6.8 04_01_0168 - 1874297-1874645,1874968-1875137,1875688-1875807,187... 27 6.8 02_05_0219 + 26870970-26873117 27 6.8 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 27 6.8 12_01_1058 - 10928128-10928163,10929082-10929199,10929391-109294... 27 8.9 11_02_0113 + 8453628-8453820,8453970-8454941,8455031-8455644 27 8.9 08_02_1084 - 24232968-24234779 27 8.9 07_01_0023 - 154119-154541,154697-154741,154875-154922,156104-15... 27 8.9 06_03_0056 - 16046535-16047309,16047625-16048784,16049233-160493... 27 8.9 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 27 8.9 03_01_0408 + 3151984-3152666,3156061-3156368,3157594-3157946 27 8.9 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 27 8.9 >01_06_1682 - 39130696-39131705,39132355-39132583 Length = 412 Score = 33.5 bits (73), Expect = 0.10 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +1 Query: 196 QQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 Q PP +++ P+ N PP YG PP N Y PP Sbjct: 242 QYTPPNSYQAPPTSYNHPPPPYGYNSPIPPT-NKYLPP 278 >06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 Length = 627 Score = 31.5 bits (68), Expect = 0.42 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +1 Query: 181 QFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 Q+G + Q PPP P P+ PP ++ P G PP Q Y Sbjct: 12 QYGFHPQAPPPP----PQYPHHPPPYAAPLPQYAPYARGMPPPQAQQLY 56 >07_01_0231 - 1698244-1700154 Length = 636 Score = 30.7 bits (66), Expect = 0.73 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 145 GLSQAFNFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNY 261 GLS A ++ + FG+N P + ++P P EPPNY Sbjct: 250 GLSTAHHYVLGWSFGMNSPAPTIDSTKLPKLP--EPPNY 286 >02_05_0218 + 26860319-26862448 Length = 709 Score = 30.7 bits (66), Expect = 0.73 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 142 GGLSQAFNFNVHGQFGVNQQRPPPN---HEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPN 312 GG + F + + ++PPP+ HE I ++P P G Q +F NH +PPN Sbjct: 205 GGGKASLGFGLFSPEATSLEQPPPSMLFHEGIDTKP----PLLGAQPQFLLNHYQPQPPN 260 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 30.3 bits (65), Expect = 0.96 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 196 QQRPPPNHEQIPSEP---NQEPPNYGEQDRFPPNHNGYRPPN 312 +++ PP+H S P EPP PP+H Y PP+ Sbjct: 944 EEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPS 985 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 202 RPPPNHEQIPSEP---NQEPPNYGEQDRFPPNHNGYRPPN 312 + PP+H S P EPP PP+H Y PP+ Sbjct: 896 KSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPS 935 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 PP E PS P PP +++ PP H+ + P Sbjct: 760 PPTPEEYTPSPPKSSPP----EEKSPPPHSPEKSP 790 >02_04_0122 - 19959137-19960043,19960150-19960714,19960932-19961202 Length = 580 Score = 30.3 bits (65), Expect = 0.96 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 PPPN +P+ PN P N Q PP + PP Sbjct: 101 PPPNQNNLPNIPNYNPYNVNHQ-YIPPFYYPPYPP 134 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +1 Query: 178 GQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRP-PNGQNGYE 330 GQ V + PP H + P PPN G PPN+ + P P G Y+ Sbjct: 252 GQGPVPPRDAPPMHHAQGNVPPPPPPNAG-----PPNYQPHAPNPQGYTNYQ 298 >09_02_0223 + 5977138-5977459,5979842-5980842 Length = 440 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP-NGQNG 324 PPP +PS P+ PP+ E D PP+ +G P +G G Sbjct: 382 PPPTMLMLPSPPSP-PPSDAEGDAPPPSGDGDEAPGSGAKG 421 >02_05_0380 + 28472494-28473090 Length = 198 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 212 GGGLC*FTPNCPCTLKLKACDSPPRTAPCTCLCTS 108 GGG+C P+C L+ C + PC C C S Sbjct: 30 GGGVC---PHCLRDRLLRLCPNCAHVRPCPCTCAS 61 >01_03_0117 + 12684729-12685886,12685978-12686145,12686292-12686336, 12686438-12687280 Length = 737 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 Query: 214 NHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 +H + PS P EPP PP H+ +PP Sbjct: 188 HHAKPPSLPPAEPPVPSPSPEHPPRHSPSKPP 219 >11_01_0620 - 4964263-4965052,4965578-4965663,4966332-4966413, 4967052-4967156,4967600-4967772,4967988-4968101, 4973939-4974037,4974320-4974398,4975424-4975492, 4975955-4976061 Length = 567 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/67 (25%), Positives = 29/67 (43%) Frame = +1 Query: 124 VQGAVLGGLSQAFNFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYR 303 + + G S + N N +G G + + P Q P P YG++ ++ +G Sbjct: 438 INPTAIPGFSSSSNANKYGDSGEDLPKAPWE-AQAPGSLPPPPARYGQRQQYFEQQHGL- 495 Query: 304 PPNGQNG 324 P+G NG Sbjct: 496 -PSGNNG 501 >07_03_1160 - 24430240-24431268 Length = 342 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 202 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 +P PN IP++P Q PN + PP N PP Sbjct: 217 QPNPNGPSIPNQPPQPIPNGPIKPDQPPQPNPDMPP 252 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +1 Query: 202 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 +P PN P +P Q PN + PP N PP Sbjct: 273 QPNPNGPPKPDQPPQPNPNGPSKPDQPPRPNPDMPP 308 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +1 Query: 184 FGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 +GVN +PPP PS P PP PP P Sbjct: 99 YGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAP 140 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 187 GVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPP 285 G QQ+ PP Q+ +P PP YG PP Sbjct: 75 GPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPP 107 >05_03_0088 - 8308587-8308649,8308682-8308738,8310403-8310501, 8311501-8311620,8311715-8311837,8312416-8312471, 8315404-8315451,8315555-8315615 Length = 208 Score = 28.7 bits (61), Expect = 2.9 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +1 Query: 178 GQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNH---NGYRPPNGQNGYE 330 GQ G ++R PPNH P E + G + F P H N + G+N Y+ Sbjct: 6 GQLG-GRERRPPNHIYAAGAPTPELVSGGVRAVFLPQHVQVNHFIQSEGKNVYD 58 >03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114, 4469273-4469314,4469496-4469572,4469671-4469755, 4469818-4469901,4469988-4470089,4470181-4470279, 4470794-4470919 Length = 1193 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 155 CDSPPRTAPCTCLCTS*APLRIPVISPPLH 66 C S P +AP T +S APL + PP H Sbjct: 27 CSSGPASAPSTSTTSSSAPLPVAAPPPPHH 56 >02_05_0591 - 30183105-30183869 Length = 254 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 226 IPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYE 330 +P P+ P ++ PP+H Y PP G E Sbjct: 175 VPPPPHPPPHHHAFHQLMPPHHGQYAPPYDMYGGE 209 >02_04_0381 - 22497519-22497769,22498157-22498247 Length = 113 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +1 Query: 214 NHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYE 330 +H+ +P+ PP++ + PP+H PP G E Sbjct: 33 DHDGGDHDPSPSPPDHEDPSPSPPDHEDEPPPPSSPGKE 71 >11_01_0727 - 6010537-6010548,6011029-6011606,6011709-6011774, 6011867-6011964,6013238-6013608 Length = 374 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 187 GVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPP--NHNGYRPPNG 315 GV RPPP H PS ++ G PP N+ PP G Sbjct: 185 GVITPRPPPVHYSKPSRTDRNRNYRGNYQNGPPQGNYQNSPPPYG 229 >02_01_0302 - 2021221-2023305 Length = 694 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 PP ++ IPS P P+ G P +GY+PP+GQ G Sbjct: 568 PPGSYGPIPSTP----PSSGSP---PSPSSGYQPPSGQPG 600 >08_02_1256 + 25645085-25645396 Length = 103 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 196 QQRPPPNHEQIPSEPNQEPPNYGEQDRFPP 285 Q PPP +PS P PP E+ PP Sbjct: 60 QPPPPPPPPPLPSPPPPPPPQQQEEQSPPP 89 >07_03_0471 + 18501496-18502104,18503009-18503260,18503367-18503537, 18503693-18503743,18503868-18503960,18504125-18504220, 18504318-18504368,18504452-18504570,18504909-18505017, 18505391-18505513,18505590-18505661,18505963-18506034, 18506125-18506191,18506260-18506402,18506494-18506565, 18506632-18506760,18507317-18507472,18507579-18507692, 18507791-18507889,18507974-18508051,18508402-18508536, 18509081-18509155,18509247-18509361,18509458-18509828, 18509903-18509965,18510049-18510120,18510285-18510413, 18510512-18510628,18510902-18511018 Length = 1289 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 85 TGILSGAHDVHKQVQGAVLGGLSQAFNF 168 TG G H H+Q +GG+ AFNF Sbjct: 1073 TGGPIGGHLAHQQSSQQAMGGMGSAFNF 1100 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGY--RPP 309 PP H PS P NY + PP +N Y +PP Sbjct: 1175 PPGPHFSGPSVPPHHGNNYHQPPSVPPPNNAYHLQPP 1211 >04_01_0168 - 1874297-1874645,1874968-1875137,1875688-1875807, 1876750-1876812 Length = 233 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 241 NQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 NQ+PP Y EQ P H P GY Sbjct: 203 NQQPPQYSEQ--LKPQHTSQHTPRHAAGY 229 >02_05_0219 + 26870970-26873117 Length = 715 Score = 27.5 bits (58), Expect = 6.8 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 5/82 (6%) Frame = +1 Query: 82 ITGILS--GAHDVHKQVQGAVLGGLSQAFNFNVHGQFGVNQQRPPPN---HEQIPSEPNQ 246 ++G+ S + H GA GG + F + + ++PPP HE I ++P Sbjct: 191 LSGVASDLSSSGAHTATGGA--GGGKASLGFGLFSPEATSLEQPPPPMLFHEGIDTKP-- 246 Query: 247 EPPNYGEQDRFPPNHNGYRPPN 312 P G Q NH ++PPN Sbjct: 247 --PLLGAQPPGLLNHYHHQPPN 266 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNH 291 PPPN++ P P+Y RFPP H Sbjct: 92 PPPNYDN-PYAHEGSFPDYEHAGRFPPAH 119 >12_01_1058 - 10928128-10928163,10929082-10929199,10929391-10929482, 10929620-10929707,10930614-10930840 Length = 186 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 282 WESILLPIIWWFLIRFARYLFMVWWWS 202 WES+ + ++ WF+ R R + WWS Sbjct: 112 WESVDVGLLAWFIRRQGRKGSLKVWWS 138 >11_02_0113 + 8453628-8453820,8453970-8454941,8455031-8455644 Length = 592 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 253 PNYGEQDRFPPNHNGYRPPNGQ 318 P EQ + N+NGYRP GQ Sbjct: 224 PETREQAMYMGNNNGYRPQGGQ 245 >08_02_1084 - 24232968-24234779 Length = 603 Score = 27.1 bits (57), Expect = 8.9 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Frame = +1 Query: 193 NQQRPPPN-HEQIPSE--PNQEPPNYGEQDRFPPNHNGYRPP 309 +QQ PPP+ +P + P+Q+ P +Q + PP H+ PP Sbjct: 56 SQQLPPPSLPPPLPQKQPPSQQLPPPPQQQQPPPQHSLPPPP 97 >07_01_0023 - 154119-154541,154697-154741,154875-154922,156104-156185, 156365-156444,156606-156677,156827-156921,157479-157515 Length = 293 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 211 PNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 P H+ +P+ P + P+ Q PP+ +G R P+G G+ Sbjct: 248 PRHK-LPASPRHKCPSSPRQP--PPHAHGPRMPDGTRGF 283 >06_03_0056 - 16046535-16047309,16047625-16048784,16049233-16049340, 16049487-16049672,16050342-16050398 Length = 761 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 83 ISPPLHSLTTNRTKITDFFSHGYY 12 +S P+ +RT T FFS+ YY Sbjct: 391 VSSPMRETEESRTNSTQFFSNAYY 414 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 PPP PS P +PP+ Q PP PP Sbjct: 82 PPPPPRNSPSPP--KPPSQAAQSPLPPTTTTTTPP 114 >03_01_0408 + 3151984-3152666,3156061-3156368,3157594-3157946 Length = 447 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 202 RPPPNHEQIPSEPNQEPPNYG 264 RPPP +Q P PP+YG Sbjct: 62 RPPPQPQQQPRVETPPPPSYG 82 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 193 NQQRPPPNHEQIPSEPNQEPPNYGEQDRFPP 285 +++RPPP P PN PP + QD PP Sbjct: 960 SEKRPPPP----PPPPNVAPPPFTRQDIPPP 986 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,921,581 Number of Sequences: 37544 Number of extensions: 268483 Number of successful extensions: 1094 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 932 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1076 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -