BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0019 (517 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 27 0.28 AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 26 0.87 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 25 1.5 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 1.5 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 24 2.6 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 24 2.6 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 24 2.6 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 24 2.6 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 2.6 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 4.6 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 4.6 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 6.1 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.1 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 23 8.1 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 8.1 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 27.5 bits (58), Expect = 0.28 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 208 PPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 PP IP P P G PP G RPP Sbjct: 86 PPRPGMIPGMPGAPPLLMGPNGPLPPPMMGMRPP 119 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 25.8 bits (54), Expect = 0.87 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 229 PSEPNQEPPNYGEQDRFPPNHNGYR-PPNGQN 321 P Q+ PN Q PP H G + PPN QN Sbjct: 195 PPGVTQQQPNMMHQQP-PPLHQGQQAPPNSQN 225 Score = 25.0 bits (52), Expect = 1.5 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +1 Query: 178 GQFGVNQQRPPPNHEQIP--SEPNQEPPN 258 G GV QQ+P H+Q P + Q PPN Sbjct: 194 GPPGVTQQQPNMMHQQPPPLHQGQQAPPN 222 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPN 288 PP +Q P+ +Q+PP + + PPN Sbjct: 195 PPGVTQQQPNMMHQQPPPLHQGQQAPPN 222 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +1 Query: 199 QRPPPNHEQIPSEPNQEPPNYGEQDRFPP 285 Q+PPP H+ + PN + + G Q P Sbjct: 208 QQPPPLHQGQQAPPNSQNASSGLQSPLYP 236 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 25.0 bits (52), Expect = 1.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 101 PLRIPVISPPLHSLTTNRTKITDFFSHG 18 P +P+++P SL TN T +HG Sbjct: 189 PAPVPIVTPVPRSLRTNNVLNTSIPNHG 216 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.0 bits (52), Expect = 1.5 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 202 RPPP-NHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 RPPP H+Q P + PN G PP RPP Sbjct: 163 RPPPIAHQQAPFAMDPARPNPG----MPPGPQMMRPP 195 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 185 NCPCTLKLKACDSPPRTAPCT 123 NC CT C +P A C+ Sbjct: 17 NCECTTDTTGCKAPSNDAVCS 37 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 185 NCPCTLKLKACDSPPRTAPCT 123 NC CT C +P A C+ Sbjct: 17 NCECTTDTTGCKAPSNDAVCS 37 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 185 NCPCTLKLKACDSPPRTAPCT 123 NC CT C +P A C+ Sbjct: 17 NCECTTDTTGCKAPSNDAVCS 37 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 185 NCPCTLKLKACDSPPRTAPCT 123 NC CT C +P A C+ Sbjct: 17 NCECTTDTTGCKAPSNDAVCS 37 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 185 NCPCTLKLKACDSPPRTAPCT 123 NC CT C +P A C+ Sbjct: 593 NCECTTDTTGCKAPSNDAVCS 613 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.4 bits (48), Expect = 4.6 Identities = 13/50 (26%), Positives = 18/50 (36%) Frame = +1 Query: 178 GQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 G+ G Q P + +P P E + D+ G P G GY Sbjct: 435 GEKGERGQMGPKGGQGVPGRPGPEGMPGDKGDKGESGSVGMPGPQGPRGY 484 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.4 bits (48), Expect = 4.6 Identities = 12/34 (35%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 229 PSEPNQ--EPPNYGEQDRFPPNHNGYRPPNGQNG 324 P E Q E P Q + PP G+ P G G Sbjct: 698 PGEKGQKGETPQLPPQRKGPPGPPGFNGPKGDKG 731 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 6.1 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 196 QQRPPPNHEQIPSEPNQEP-PNYGEQD 273 Q +P HE IP EP QEP Y E++ Sbjct: 1034 QLKPLKLHE-IPEEPPQEPLKEYTEEE 1059 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 226 IPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 IP P Q+P + ++ G +PP G G Sbjct: 2980 IPPAPEQQPVRHQQRPSLISMLTGVQPPGGFPG 3012 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +1 Query: 193 NQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNG 297 NQ+ N +P + Q P + + ++P NG Sbjct: 248 NQRGNKQNGVNLPQQSAQRQPAHRQHQQWPHQQNG 282 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 313 RSEVCIRCGWVG 278 R +CIRCG VG Sbjct: 681 RQNMCIRCGVVG 692 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 490,902 Number of Sequences: 2352 Number of extensions: 11076 Number of successful extensions: 36 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -