BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0019 (517 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39740.1 68415.m04880 expressed protein 34 0.065 At2g15690.1 68415.m01796 pentatricopeptide (PPR) repeat-containi... 33 0.15 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 32 0.26 At4g19590.1 68417.m02879 DNAJ heat shock N-terminal domain-conta... 32 0.26 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 0.35 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 0.35 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 31 0.46 At2g37780.1 68415.m04639 DC1 domain-containing protein contains ... 31 0.61 At5g04940.2 68418.m00523 SET domain-containing protein (SUVH1) c... 30 0.80 At5g04940.1 68418.m00522 SET domain-containing protein (SUVH1) c... 30 0.80 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 30 0.80 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 30 0.80 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 30 0.80 At4g08013.1 68417.m01283 hypothetical protein low similarity to ... 30 1.1 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 1.4 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 29 1.9 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 29 1.9 At2g18470.1 68415.m02151 protein kinase family protein contains ... 29 1.9 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 2.5 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 29 2.5 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 29 2.5 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 28 3.2 At4g25520.1 68417.m03680 transcriptional co-regulator family pro... 28 3.2 At3g30520.1 68416.m03863 hypothetical protein 28 3.2 At1g33680.1 68414.m04166 KH domain-containing protein similar to... 28 3.2 At5g56250.2 68418.m07020 expressed protein 28 4.3 At5g56250.1 68418.m07019 expressed protein 28 4.3 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 28 4.3 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 28 4.3 At4g17060.1 68417.m02572 expressed protein 28 4.3 At3g24550.1 68416.m03083 protein kinase family protein contains ... 28 4.3 At3g14595.1 68416.m01848 expressed protein 28 4.3 At2g23440.1 68415.m02798 expressed protein 28 4.3 At5g18700.1 68418.m02219 protein kinase-related contains protein... 27 5.7 At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99... 27 5.7 At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99... 27 5.7 At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99... 27 5.7 At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99... 27 5.7 At1g75240.1 68414.m08741 zinc finger homeobox family protein / Z... 27 5.7 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 27 5.7 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 27 5.7 At1g03530.1 68414.m00334 expressed protein similar to hypothetic... 27 5.7 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 27 7.5 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 27 7.5 At3g22350.1 68416.m02822 F-box family protein similar to F-box p... 27 7.5 At2g45490.1 68415.m05658 protein kinase, putative contains prote... 27 7.5 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 27 7.5 At1g50150.1 68414.m05624 hypothetical protein similar to hypothe... 27 7.5 At1g23540.1 68414.m02960 protein kinase family protein contains ... 27 7.5 At4g24580.1 68417.m03522 pleckstrin homology (PH) domain-contain... 27 9.9 At4g23040.1 68417.m03322 UBX domain-containing protein similar t... 27 9.9 At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family... 27 9.9 At2g29380.1 68415.m03569 protein phosphatase 2C, putative / PP2C... 27 9.9 At2g11405.1 68415.m01224 hypothetical protein 27 9.9 At2g01600.1 68415.m00084 epsin N-terminal homology (ENTH) domain... 27 9.9 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 27 9.9 >At2g39740.1 68415.m04880 expressed protein Length = 474 Score = 33.9 bits (74), Expect = 0.065 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 4/84 (4%) Frame = +1 Query: 55 VVSECNGGLITGILSGAHDVHKQVQGAVLGGLSQAFNF----NVHGQFGVNQQRPPPNHE 222 +VSECN I GIL+G H + L A N+HGQ Q+ N Sbjct: 294 LVSECNRNSIIGILTGQHIQESLYRTISLPSQHHANGMHNVRNLHGQARPQNQQMQQNWS 353 Query: 223 QIPSEPNQEPPNYGEQDRFPPNHN 294 Q + PN PP++ + P N Sbjct: 354 QSYNTPN--PPHWPPLTQSRPQQN 375 >At2g15690.1 68415.m01796 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 579 Score = 32.7 bits (71), Expect = 0.15 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Frame = +1 Query: 97 SGAHDVHKQVQGAVLGGLSQAF---NFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGE 267 + A+D H+ Q + + +F+ Q NQ R P + Q ++ + P YG Sbjct: 53 AAANDYHQNPQSGSPSQHQRPYPPQSFDSQNQTNTNQ-RVPQSPNQWSTQHGGQIPQYGG 111 Query: 268 QDRFPPNHNGYRPP-NGQN 321 Q+ P H G RPP GQN Sbjct: 112 QN---PQHGGQRPPYGGQN 127 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 31.9 bits (69), Expect = 0.26 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = +1 Query: 196 QQRPPPNHEQIPSEPNQEPPNYGEQDR---FPP---NHNGYRPPNGQNG 324 Q PPP + P P PP YG Q R PP G PP+G G Sbjct: 170 QGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQG 218 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/49 (38%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 187 GVNQQRPPPNHEQ--IPSEPNQEPPNYGEQDRFPPNHNGY--RPPNGQN 321 G+ + PPP+ Q PS P PP G F P H G PPN N Sbjct: 205 GMMRGPPPPHGMQGPPPSRPGMPPP--GGAPMFAPPHPGMPPAPPNHHN 251 >At4g19590.1 68417.m02879 DNAJ heat shock N-terminal domain-containing protein protein YJL162c, Saccharomyces cerevisiae, PIR2:S56945; contains Pfam PF00226: DnaJ domain; Length = 345 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 193 NQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPN 312 NQQ+ PP+ ++ P ++PPN +Q P + +PPN Sbjct: 149 NQQKQPPDQQKQPPNQPRQPPNQQKQ----PQNEPKQPPN 184 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 193 NQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPN 288 NQ R PPN ++ P ++PPN Q + PPN Sbjct: 163 NQPRQPPNQQKQPQNEPKQPPN---QPKQPPN 191 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 193 NQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPN 288 NQ + PN ++ P + ++PPN Q R PPN Sbjct: 142 NQPKQQPNQQKQPPDQQKQPPN---QPRQPPN 170 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.5 bits (68), Expect = 0.35 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPN 312 PPP ++ PS P+ PP + PP+H+ P N Sbjct: 135 PPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSN 170 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 31.5 bits (68), Expect = 0.35 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNG 315 PPP+H P + PP + PP HN +PP G Sbjct: 619 PPPSHSPPPPVYSPPPPTFSP----PPTHNTNQPPMG 651 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = +1 Query: 187 GVNQQRPPPNHEQIPSEPNQ-EPPNYGEQDRFPPNHNGYRPPNG---QNGYE 330 G PPP + P P PP++ E P + GY PP+ + GY+ Sbjct: 15 GYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYPPPSSRPYEGGYQ 66 >At2g37780.1 68415.m04639 DC1 domain-containing protein contains Pfam PF03107: DC1 domain Length = 286 Score = 30.7 bits (66), Expect = 0.61 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 7/53 (13%) Frame = +1 Query: 190 VNQQRPPPNHEQIPSEPNQEP-------PNYGEQDRFPPNHNGYRPPNGQNGY 327 V +QR H PS P+Q P+ G+ + +PP GY+P N QN Y Sbjct: 121 VTKQRSLHGHAGQPSPPHQYGQGIPYGYPHMGQPEPYPPQGGGYQPQN-QNYY 172 >At5g04940.2 68418.m00523 SET domain-containing protein (SUVH1) contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH1 (SUVH1) GI:13517742 Length = 670 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 190 VNQQRPPPNHEQIPSEP---NQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 +NQ + PP H+Q + P Q+PP + + +R P+ NG Sbjct: 67 LNQAQYPPQHQQPQNPPPVYQQQPPQHASEPSLVTPLRSFRSPDVSNG 114 >At5g04940.1 68418.m00522 SET domain-containing protein (SUVH1) contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH1 (SUVH1) GI:13517742 Length = 670 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 190 VNQQRPPPNHEQIPSEP---NQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 +NQ + PP H+Q + P Q+PP + + +R P+ NG Sbjct: 67 LNQAQYPPQHQQPQNPPPVYQQQPPQHASEPSLVTPLRSFRSPDVSNG 114 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 30.3 bits (65), Expect = 0.80 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 Query: 202 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNG 315 RPPP Q P Q+ P+YG R P + PP G Sbjct: 56 RPPPPFGQSPQPFPQQSPSYGAPQRGPSPMSRPGPPAG 93 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 30.3 bits (65), Expect = 0.80 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 208 PPNHEQIPSEPNQEPPNYGEQDRFPPNH-NGYRPPNG 315 PP IP + PPNY PP H N PP+G Sbjct: 150 PPGMAPIPGQGGGPPPNYNGLPPPPPYHTNPAAPPSG 186 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 175 HGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNG 297 HG G +PPP+H + +PP +G + PP+H G Sbjct: 43 HGGGGGGGSKPPPHHG---GKGGGKPPPHGGKGGGPPHHGG 80 >At4g08013.1 68417.m01283 hypothetical protein low similarity to SCARECROW [Zea mays] GI:10178637 Length = 113 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFP-PNHNGYRPPNGQ 318 PPP E+ P E P EQ P PN Y P+ Q Sbjct: 57 PPPRSEEAQFNPPPEAPLNQEQSESPNPNSQAYTHPSSQ 95 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 196 QQRPPPNHEQIPSEPNQEPPNYGEQ-DRFPPNHNGYRPPNGQ 318 Q PPP+ PS P PP+ PP+ + PP+ Q Sbjct: 27 QSSPPPSDSSSPSPPAPPPPDDSSNGSPQPPSSDSQSPPSPQ 68 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +1 Query: 205 PPPNHEQ--IPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 PP + Q P P PP +PP GY P G GY Sbjct: 28 PPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGY 70 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYE 330 PPP PS N PP Y PP H Y PP G + ++ Sbjct: 244 PPP-----PSASNLYPPPYYSTS--PPQHQSYPPPPGHSFHQ 278 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGY-RPPNGQNGY 327 PPP H ++P+Q +G P N +GY PP GY Sbjct: 270 PPPGHSFHQTQPSQS--FHGFAPSSPQNQHGYGYPPPTSPGY 309 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/48 (31%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 187 GVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNH--NGYRPPNGQNG 324 G + PPP+ P+ PPN PP+ G R G NG Sbjct: 43 GDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPPSQGGGGERGNGGNNG 90 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = +1 Query: 187 GVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYE 330 G N + PP + P P ++PP++ P PP + Y+ Sbjct: 350 GYNPEEPPYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYD 397 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 199 QRPPPNHEQIPSEPNQEPPNYGEQDRFPPN 288 Q+PPP + PS N E P Y +Q +PPN Sbjct: 339 QQPPPQLQH-PSGYNPEEPPYPQQS-YPPN 366 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 181 QFGVNQQR--PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 QF Q+ PPP+H P P PP Y P+ Y+ P Q Y Sbjct: 278 QFSSQQEPYCPPPSH---PQPPPSNPPPYQAPQTQTPHQPSYQSPPQQPQY 325 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = +1 Query: 205 PPPNHE---QIPSEPN-QEPPNYGEQDRFPPNHNGYRP 306 PPP Q P +P+ Q PP + + PP +GY P Sbjct: 300 PPPYQAPQTQTPHQPSYQSPPQQPQYPQQPPPSSGYNP 337 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 142 GGLSQAFNFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNY 261 G S ++ HG + +Q PPP++ P Q+ P Y Sbjct: 384 GASSSSYTMPPHGHYPQHQPYPPPSYGGYMQPPYQQYPPY 423 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 196 QQRPPPNHEQIPSEPNQEP-PNYGEQDRFPPNHNGYRPP 309 +Q PPP + P E P Y Q+++PP Y PP Sbjct: 144 EQYPPPIKKYPPPEHYPPPIKKYPPQEQYPPPIKKYPPP 182 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 196 QQRPPPNHEQIPSEPNQEP-PNYGEQDRFPPNHNGYRPP 309 +Q PPP + P E P Y +++PP Y PP Sbjct: 118 EQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPP 156 >At4g25520.1 68417.m03680 transcriptional co-regulator family protein contains similarity to GP|18033922|gb|AAL57277 SEUSS transcriptional co-regulator [Arabidopsis thaliana] Length = 748 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 163 NFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPN 258 N N Q G + Q P PN Q PS +Q+ N Sbjct: 578 NSNTGKQEGFSSQNPTPNSNQSPSSSSQQRHN 609 >At3g30520.1 68416.m03863 hypothetical protein Length = 397 Score = 28.3 bits (60), Expect = 3.2 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +1 Query: 202 RPPPNHEQIPSEPN----QEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 R PPN Q + PN + PPN PPN +G P N Q G+ Sbjct: 296 RTPPNVAQWGTPPNVAQCRTPPNAPHWGT-PPNAHGTTPTNVQYGF 340 >At1g33680.1 68414.m04166 KH domain-containing protein similar to FUSE binding protein 2 GB:AAC50892 GI:1575607 from [Homo sapiens] Length = 759 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 PP + P P+ P NY +P + +RPPN GY Sbjct: 411 PPQWGSRGPHGPHSMPYNYHHGGPYPSQGSHFRPPN-SGGY 450 >At5g56250.2 68418.m07020 expressed protein Length = 811 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 190 VNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 V QR P+H + +P + + + + P+ N PP NGY Sbjct: 755 VINQREEPSHNESSPKPTSQFLDLSKTQQASPSVNLLHPPYSGNGY 800 >At5g56250.1 68418.m07019 expressed protein Length = 811 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 190 VNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 V QR P+H + +P + + + + P+ N PP NGY Sbjct: 755 VINQREEPSHNESSPKPTSQFLDLSKTQQASPSVNLLHPPYSGNGY 800 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +1 Query: 202 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYR----PPNGQNG 324 RPPP +Q P PP YG++ PP R PP+G G Sbjct: 189 RPPP--QQFSGPP---PPQYGQRPMIPPPGGMMRGPPPPPHGMQG 228 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +1 Query: 202 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYR----PPNGQNG 324 RPPP +Q P PP YG++ PP R PP+G G Sbjct: 189 RPPP--QQFSGPP---PPQYGQRPMIPPPGGMMRGPPPPPHGMQG 228 >At4g17060.1 68417.m02572 expressed protein Length = 310 Score = 27.9 bits (59), Expect = 4.3 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = +1 Query: 163 NFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 NF HG N +P PN Q ++ + E++ F P R + NGY Sbjct: 146 NFASHGFKPKNFSKPEPNFSQDLDYDDEFDDDRAEREGFNPRIQSSRSSSRVNGY 200 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 211 PNHEQIPSEPNQEPPN--YGEQDRFPPNHNGYRPPNGQNG 324 P++ + P PNQ PPN G R P N P + +G Sbjct: 96 PSNPRSPPSPNQGPPNTPSGSTPRTPSNTKPSPPSDSSDG 135 >At3g14595.1 68416.m01848 expressed protein Length = 132 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 193 NQQRPPPNHEQIPS-EPNQEPPNYGEQDRFPPNHNGY 300 +QQ+PPP + + + P Q+PP G P GY Sbjct: 18 HQQQPPPPFQGVSNYPPQQQPPATGYPQPAQPYAQGY 54 >At2g23440.1 68415.m02798 expressed protein Length = 82 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 229 PSEPNQEPPNYGEQDRFPPNHNGYRPPNGQN 321 P+EP + PP++G D F P G+ P G + Sbjct: 50 PTEPLESPPSHG-VDTFRPTEPGHSPGIGHS 79 >At5g18700.1 68418.m02219 protein kinase-related contains protein kinase domain, INTERPRO:IPR000719 Length = 1366 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +1 Query: 187 GVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYE 330 G+N + P E+ PN+ PP Y E+DR + G G+E Sbjct: 273 GINTK--PCLSERNGDRPNKTPPKYREKDRKGGSKQNENSIQGSKGHE 318 >At5g14420.4 68418.m01687 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 PPP++ Q P PP Y Q P+++ PP+ G Sbjct: 48 PPPSYAQPPEYTQPPPPLYSTQPYSAPSYSA--PPSQSYG 85 >At5g14420.3 68418.m01686 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 PPP++ Q P PP Y Q P+++ PP+ G Sbjct: 48 PPPSYAQPPEYTQPPPPLYSTQPYSAPSYSA--PPSQSYG 85 >At5g14420.2 68418.m01685 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 PPP++ Q P PP Y Q P+++ PP+ G Sbjct: 48 PPPSYAQPPEYTQPPPPLYSTQPYSAPSYSA--PPSQSYG 85 >At5g14420.1 68418.m01684 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 468 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 PPP++ Q P PP Y Q P+++ PP+ G Sbjct: 48 PPPSYAQPPEYTQPPPPLYSTQPYSAPSYSA--PPSQSYG 85 >At1g75240.1 68414.m08741 zinc finger homeobox family protein / ZF-HD homeobox family protein Length = 309 Score = 27.5 bits (58), Expect = 5.7 Identities = 23/91 (25%), Positives = 36/91 (39%), Gaps = 13/91 (14%) Frame = +1 Query: 76 GLITGILSGAHDVHKQVQGAVLGGL--SQAFNFNVHGQFGVNQ------QRPPP-----N 216 G I + A D H+ + G+ S + + H + NQ +RPPP N Sbjct: 105 GTIEALRCAACDCHRNFHRKEMDGVGSSDLISHHRHHHYHHNQYGGGGGRRPPPPNMMLN 164 Query: 217 HEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 +P PN +P ++ + PP G P Sbjct: 165 PLMLPPPPNYQPIHHHKYGMSPPGGGGMVTP 195 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +1 Query: 196 QQRPPPNHEQIPSE----PNQEPPNYGEQDRFPP 285 Q PPP +EQ PS P+ PP Y PP Sbjct: 576 QSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPP 609 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPP 309 PPP + S P PP Y PP Y PP Sbjct: 608 PPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPP 642 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 193 NQQRPPPNHEQIPSEPNQE-PPNYGEQDRFPPNHNGYRPP 309 +Q PPP + +PS Q+ PPN+ Q P H Y PP Sbjct: 389 HQSYPPPPYGYMPSPYQQQYPPNHHHQPS-PMQH--YAPP 425 >At1g03530.1 68414.m00334 expressed protein similar to hypothetical protein GB:O14360 Length = 797 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 232 SEPNQEPPNYGEQDRFPPNHNGYRP-PNGQNGYE 330 S+P P + D FPPN+ +RP N QN Y+ Sbjct: 553 SDPQMGGPR-PQMDGFPPNNAAWRPQSNQQNPYQ 585 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/49 (30%), Positives = 19/49 (38%) Frame = +1 Query: 181 QFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNGY 327 Q G+N Q + PS Q PN G +P G+ P GY Sbjct: 638 QGGMNPQMSQSHFMGAPSGVFQGQPNSGGPQMYPQGRGGFNRPQMIPGY 686 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 27.1 bits (57), Expect = 7.5 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +1 Query: 181 QFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQ 318 Q G Q P + P P PP Y Q PP H G PP + Sbjct: 536 QQGYGQGYPAQGYPP-PQYPQGHPPQYPYQGP-PPPHYGQAPPKNK 579 >At3g22350.1 68416.m02822 F-box family protein similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 378 Score = 27.1 bits (57), Expect = 7.5 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 252 WFLIRFARYLFMVWWWSLLIHAKLSMYVEV 163 W+L RF+ WWW I+ + V++ Sbjct: 348 WWLCRFSEKFTKKWWWFPFIYNYVPSLVQI 377 >At2g45490.1 68415.m05658 protein kinase, putative contains protein kinase domain, Pfam:PF00069; similar to protein kinase p46XlEg22 [Xenopus laevis] gi|609280|emb|CAA78914 Length = 288 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/57 (24%), Positives = 28/57 (49%) Frame = +1 Query: 46 VLLVVSECNGGLITGILSGAHDVHKQVQGAVLGGLSQAFNFNVHGQFGVNQQRPPPN 216 + L++ +GG + G+L + +Q + LSQA + HG+ +++ P N Sbjct: 95 IFLILEYAHGGELYGVLKQNGHLTEQQAATYIASLSQALAY-CHGKCVIHRDIKPEN 150 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +1 Query: 202 RPPPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 +PPP Q+P P PP + PP PP G G Sbjct: 707 KPPP--VQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYG 745 >At1g50150.1 68414.m05624 hypothetical protein similar to hypothetical protein GB:AAD50048 GI:5734783 from [Arabidopsis thaliana] Length = 358 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 163 NFNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDR 276 +F+ H Q GV Q N+E+ SE +E P +++R Sbjct: 98 HFDSHAQLGVQDQIEWLNNEKRASESRKESPFLNKRER 135 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +1 Query: 205 PPPNHEQIPSEPNQE-----PPNYGEQDRFPPNHNGYRPP 309 PPP + PS P PPN + PP+ + PP Sbjct: 95 PPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPP 134 >At4g24580.1 68417.m03522 pleckstrin homology (PH) domain-containing protein-related / RhoGAP domain-containing protein contains Pfam domain, PF00620: RhoGAP domain Length = 902 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 208 PPNHEQIPSEPNQEPPNYGEQDRFPPNHNGYRPPNGQNG 324 PP H Q + Q+PP EQ++ P PP Q+G Sbjct: 12 PPPHVQPNQQQQQQPPIANEQEQEPHGDTCSIPP-AQSG 49 >At4g23040.1 68417.m03322 UBX domain-containing protein similar to Ara4-interacting protein [Arabidopsis thaliana] GI:13160609; contains Pfam profile PF00789: UBX domain Length = 525 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 88 GILSGAHDVHKQVQGAVLGGLSQAFNFNVHGQFGVNQQRPP 210 GI S HD ++ A+ GG+S++ + + QRPP Sbjct: 321 GISSEEHDEAIMLEAAMFGGISESEYGVPYAHYPQRTQRPP 361 >At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family protein similar to Mrs16p (GI:2737884) [Saccharomyces cerevisiae]; weak similarity to ataxin-2 related protein (GI:1679686) [Homo sapiens] Length = 595 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/47 (31%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = +1 Query: 205 PPPNHEQIPSEPNQEPPNY------GEQDRFPPNHNGYRPPNGQNGY 327 P P+H + P P NY G Q + + Y PNGQ Y Sbjct: 505 PGPSHVPVQQMPGMPPVNYGLPPYPGNQPQMMYHPQAYYHPNGQPQY 551 >At2g29380.1 68415.m03569 protein phosphatase 2C, putative / PP2C, putative contains PF00481: Protein phosphatase 2C domain; similar to protein phpsphatase 2C (PP2C) (GI:7768151) [Fagus sylvatica]. Length = 362 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 191 TPNCPCTLKLKACDSPPRTA 132 T NC C L+ ACDS TA Sbjct: 174 TANCKCDLQTPACDSVGSTA 193 >At2g11405.1 68415.m01224 hypothetical protein Length = 115 Score = 26.6 bits (56), Expect = 9.9 Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = -2 Query: 261 IIWWFLIR---FARYLFMVWWWS 202 ++WW LI F ++F++WW S Sbjct: 15 LLWWALIGERGFELFIFLLWWLS 37 >At2g01600.1 68415.m00084 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to clathrin assembly protein AP180 (GI:6492344) [Xenopus laevis] Length = 571 Score = 26.6 bits (56), Expect = 9.9 Identities = 19/70 (27%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +1 Query: 103 AHDVHKQVQGAVLGGLSQAFN--FNVHGQFGVNQQRPPPNHEQIPSEPNQEPPNYGEQDR 276 +HD G QA N F + Q +Q +P H+ P N P +G+ Sbjct: 481 SHDPFASSNGTAPPPQQQAVNNPFGAYQQTYQHQPQPTYQHQSNPPTNNSNP--FGDFGE 538 Query: 277 FPPNHNGYRP 306 FP N +P Sbjct: 539 FPVNPVSQQP 548 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 205 PPPNHEQIPS-EPNQEPPNYGEQDRFPPNHNGYRPPNGQNGYE 330 PPP+ P+ P+ +PPN + R PP PPN Y+ Sbjct: 205 PPPHIGNNPNMPPHIQPPNMNQNYRGPP-----PPPNMNQNYQ 242 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,148,872 Number of Sequences: 28952 Number of extensions: 208598 Number of successful extensions: 892 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -