BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0011 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 2.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 8.3 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 626 NLNFLNIHSNKTYNVKLKDELYKNI*FI 543 +L+ IH+N YN +LY NI +I Sbjct: 306 SLSNKTIHNNNNYNNYNNKKLYYNINYI 333 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 635 KNENLNFLNIHSNKTYNVKLKDELYKN 555 K N N N ++N YN K YKN Sbjct: 323 KYSNYNNYNNYNNNNYNNYNKKLYYKN 349 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 8.3 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -3 Query: 211 TRFD*SIANVASHFLNFLEELPPGLGSSADRAESQHQREDE 89 TR S+A A L + PG+ + A ++ EDE Sbjct: 400 TRSGYSVARFAETALGAAALVAPGMEEPTNTASGSNEDEDE 440 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,846 Number of Sequences: 438 Number of extensions: 3385 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -