SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0005
         (643 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase ...    24   1.2  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    24   1.2  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    24   1.2  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    24   1.2  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    24   1.2  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    24   1.2  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    24   1.2  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    24   1.2  
DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    21   6.5  

>AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase
           protein.
          Length = 268

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 206 VGCVLHSPGC 235
           +GCVL SPGC
Sbjct: 221 IGCVLCSPGC 230


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 206 VGCVLHSPGC 235
           +GCVL SPGC
Sbjct: 535 IGCVLCSPGC 544


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 206 VGCVLHSPGC 235
           +GCVL SPGC
Sbjct: 795 IGCVLCSPGC 804


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 206 VGCVLHSPGC 235
           +GCVL SPGC
Sbjct: 795 IGCVLCSPGC 804


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 206 VGCVLHSPGC 235
           +GCVL SPGC
Sbjct: 768 IGCVLCSPGC 777


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 206 VGCVLHSPGC 235
           +GCVL SPGC
Sbjct: 768 IGCVLCSPGC 777


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 206 VGCVLHSPGC 235
           +GCVL SPGC
Sbjct: 795 IGCVLCSPGC 804


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = +2

Query: 206 VGCVLHSPGC 235
           +GCVL SPGC
Sbjct: 795 IGCVLCSPGC 804


>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +3

Query: 222 THQVAAKGWFIAMVSTTVETNDPESEIRPGL 314
           TH + A GW      ++ E+ND   + + GL
Sbjct: 117 THIIFAFGWLKKGKLSSFESNDETKDGKVGL 147


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,476
Number of Sequences: 336
Number of extensions: 3580
Number of successful extensions: 11
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16448590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -