BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0005 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 24 4.7 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 4.7 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 24 4.7 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 8.2 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 8.2 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 23.8 bits (49), Expect = 4.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 432 FETTCLDVLKIYKHGTGEEFDFSKVKLELGEE 527 F T CL L K G+ EF+ V+ E E+ Sbjct: 6 FVTGCLLALAFAKAGSYHEFELYNVRPETAEQ 37 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.8 bits (49), Expect = 4.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 206 VGCVLHSPGC 235 +GCVL SPGC Sbjct: 454 IGCVLCSPGC 463 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 23.8 bits (49), Expect = 4.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 432 FETTCLDVLKIYKHGTGEEFDFSKVKLELGEE 527 F T CL L K G+ EF+ V+ E E+ Sbjct: 6 FVTGCLLALAFAKAGSYHEFELYNVRPETAEQ 37 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 629 YKVTIH*GFSLNKQLNNKQYTYYFFM 552 Y+V I F +N++L+ Q YY M Sbjct: 497 YRVCIEKFFRMNRELHRLQTMYYEMM 522 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.0 bits (47), Expect = 8.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -3 Query: 560 FFMRPLSYLLILFTKFQLDFREIKFFPSTMFINFKHIQTSCFKV 429 FF R L ++++ K+Q D+ ++ P F IQ +CF V Sbjct: 955 FFDRLL--IMLMPAKYQPDYMFLRQVPIRRVHLFTMIQLACFAV 996 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,357 Number of Sequences: 2352 Number of extensions: 14191 Number of successful extensions: 33 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -