BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0004 (639 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC417.15 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual 26 4.0 SPAC23C4.10 |sec2||guanyl-nucleotide exchange factor Sec2 |Schiz... 25 9.2 >SPCC417.15 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual Length = 43 Score = 26.2 bits (55), Expect = 4.0 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +3 Query: 198 FICHIKNS*ACCKNHF-NMLI*IV 266 FI HI S CC+NHF N L+ ++ Sbjct: 15 FIIHIHFSHHCCENHFINPLVCLI 38 >SPAC23C4.10 |sec2||guanyl-nucleotide exchange factor Sec2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 25.0 bits (52), Expect = 9.2 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 229 VARIISIC*FKSLLKKVFKGFKSI*EID*RWR*C 330 VAR+ S+C F + L ++ KG S ++ W C Sbjct: 474 VARLRSVCNFVAFLHQICKGVWSSCSLEKAWDEC 507 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,188,032 Number of Sequences: 5004 Number of extensions: 36437 Number of successful extensions: 55 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -