BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0003 (618 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C su... 44 1e-04 At3g56450.1 68416.m06278 alpha-soluble NSF attachment protein 1 ... 29 1.9 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 28 5.7 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 28 5.7 At1g17960.1 68414.m02222 threonyl-tRNA synthetase, putative / th... 28 5.7 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 27 7.5 At1g62260.1 68414.m07024 pentatricopeptide (PPR) repeat-containi... 27 7.5 At5g11040.1 68418.m01290 expressed protein weak similarity to hy... 27 10.0 At4g08450.1 68417.m01393 disease resistance protein (TIR-NBS-LRR... 27 10.0 At3g48380.2 68416.m05281 expressed protein 27 10.0 At3g48380.1 68416.m05280 expressed protein 27 10.0 At3g18215.1 68416.m02317 expressed protein contains Pfam profile... 27 10.0 >At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C subunit family protein similar to ATPase subunit 9 [Arabidopsis thaliana] GI:15215920; contains Pfam profile PF00137: ATP synthase subunit C Length = 85 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +3 Query: 315 FGSLIIGYARNPSLKQQLFSYAILGFALSE 404 F SLI ARNPSL +Q F YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQSFGYAILGFALTE 68 >At3g56450.1 68416.m06278 alpha-soluble NSF attachment protein 1 / alpha-SNAP1 (ASNAP1) identical to alpha-soluble NSF attachment protein 1 (Alpha-SNAP1) (N- ethylmaleimide-sensitive factor attachment protein, alpha 1) (Swiss-Prot:Q9LXZ5) [Arabidopsis thaliana] Length = 381 Score = 29.5 bits (63), Expect = 1.9 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 3/85 (3%) Frame = -2 Query: 596 CNTHQSLHHYEG-EVSKHSIPWLSTP-DSIH*NLICRMAVVVFLKVNSLESE-EQQERHH 426 C H+ +YE E+ + +I + T + + A LKV S+ EQQ R Sbjct: 167 CMDHEIAEYYESDEMFEQAIAYYETAAEFFQIEEVTTSANQCNLKVAQYASQLEQQSRFM 226 Query: 425 KTEQTHSLRQGETQNGV*EQLLLEG 351 KT+ HSL + GV LL G Sbjct: 227 KTQARHSLNNKLLKYGVKGHLLTAG 251 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 27.9 bits (59), Expect = 5.7 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 49 LIKTKCCLPPD*SPLQPGLPSSATLH--WCDHLQQYPPI 159 L++ CC + P LPS LH +C LQ +P I Sbjct: 682 LLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEI 720 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -3 Query: 253 NLAAESMSLVTDVVWKDRTAESCVGTAGTICVWVGTAASGRTS 125 N+A+E + L+ ++ CV +C+ VG ++SG+TS Sbjct: 2028 NIASEQLKLLPEIRQNLEAVAHCVQNKW-LCILVGPSSSGKTS 2069 >At1g17960.1 68414.m02222 threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative similar to SP|O04630 Threonyl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.3) (Threonine--tRNA ligase) (ThrRS) {Arabidopsis thaliana}; contains Pfam profiles PF00587: tRNA synthetase class II core domain (G, H, P, S and T), PF03129: Anticodon binding domain, PF02824: TGS domain Length = 458 Score = 27.9 bits (59), Expect = 5.7 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 208 SRPHRSLRTLTLLPNSLVLVQRQWE*LVPELVLEQSSAPSSSAM 339 SRPH ++ +TLLP+ + R+WE ++ ++ S + SA+ Sbjct: 37 SRPHDPIK-ITLLPDGIEKEGRRWETSPMDIAVQISKGLAKSAL 79 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 341 GIADDEGAEDCSNTSSGTSYSHCRCTSTNEFG 246 GI DD+G ++ + S + R T+EFG Sbjct: 660 GIVDDDGGKESKDKESKDRFKDIRIERTDEFG 691 >At1g62260.1 68414.m07024 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 656 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = -2 Query: 593 NTHQSLHHYEGEVSKHSIPWLSTPDSIH*NLICRMAVVVFLKVNSLESEE 444 N + H++E KH++ W S + N + AV +F+++N +E E+ Sbjct: 358 NVELARHYFEKTPEKHTVSWNSIIAAYEKNKDYKEAVDLFIRMN-IEGEK 406 >At5g11040.1 68418.m01290 expressed protein weak similarity to hypercellular protein [Aspergillus nidulans] GI:9309269 Length = 1186 Score = 27.1 bits (57), Expect = 10.0 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 236 NVLSDRCGLEGPHCRELCRDSRYHLCMGG 150 NVL R G P+ CR +H+C+ G Sbjct: 1155 NVLRARAGTASPNEPIFCRGPPFHVCVAG 1183 >At4g08450.1 68417.m01393 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1234 Score = 27.1 bits (57), Expect = 10.0 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 332 DDEGAEDCSNTSSGTSYS-HCRCTSTNEFGSRVNVLSD 222 DDE ++D + SS T YS C + ++ G+ ++ D Sbjct: 1108 DDESSDDDDDLSSETDYSDECEDSDDSDLGNEIDYSED 1145 >At3g48380.2 68416.m05281 expressed protein Length = 640 Score = 27.1 bits (57), Expect = 10.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 284 SWFRSWYWNSLRLPHHRLCQEPL 352 SWFR ++ S+ +P HR Q+ L Sbjct: 477 SWFRLQHYTSISVPSHREIQQTL 499 >At3g48380.1 68416.m05280 expressed protein Length = 645 Score = 27.1 bits (57), Expect = 10.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 284 SWFRSWYWNSLRLPHHRLCQEPL 352 SWFR ++ S+ +P HR Q+ L Sbjct: 482 SWFRLQHYTSISVPSHREIQQTL 504 >At3g18215.1 68416.m02317 expressed protein contains Pfam profile PF04654: Protein of unknown function, DUF599 Length = 244 Score = 27.1 bits (57), Expect = 10.0 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +1 Query: 382 FWVSPCLRLWVCSVL*WRSCCSSLSKLFTFKNTTTAIL-HMRFQCILSGVDS 534 F+ S L LW + CC +S + F +TTT+ H+ Q DS Sbjct: 181 FYFSFPLFLWTFGPIPMFVCCCMMSSILYFLDTTTSFTRHLHSQSFRETADS 232 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,034,104 Number of Sequences: 28952 Number of extensions: 299826 Number of successful extensions: 929 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -