Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP27_F_K14
         (1001 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    27   0.35 
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    23   3.3  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   3.3  
DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    23   5.7  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 26.6 bits (56), Expect = 0.35
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 890  PPPPPPPP 913
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 26.6 bits (56), Expect = 0.35
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +3

Query: 939  PPPPPPPP 962
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 26.6 bits (56), Expect = 0.35
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 940  PPPPPPPP 963
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 23.4 bits (48), Expect = 3.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 890 PPPPPPPP 913
           P PPPPPP
Sbjct: 341 PAPPPPPP 348



 Score = 23.4 bits (48), Expect = 3.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 939 PPPPPPPP 962
           P PPPPPP
Sbjct: 341 PAPPPPPP 348



 Score = 23.4 bits (48), Expect = 3.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 941 PPPPPPPP 964
           P PPPPPP
Sbjct: 341 PAPPPPPP 348


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.4 bits (48), Expect = 3.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 890  PPPPPPPP 913
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864



 Score = 23.4 bits (48), Expect = 3.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +3

Query: 939  PPPPPPPP 962
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864



 Score = 23.4 bits (48), Expect = 3.3
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 941  PPPPPPPP 964
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864


>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 22.6 bits (46), Expect = 5.7
 Identities = 10/32 (31%), Positives = 15/32 (46%)
 Frame = +3

Query: 153 SXGVKNXXPXLSXXFXKNPPPXFLGTPGFYWF 248
           S  +K+  P     + K+  P FLG P   +F
Sbjct: 3   SLSLKDILPLNPKLYDKHRAPKFLGQPTIVYF 34


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 269,412
Number of Sequences: 438
Number of extensions: 11552
Number of successful extensions: 66
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 33258225
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)