Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP27_F_D05
         (894 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    24   1.6  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    23   2.8  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    23   2.8  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    23   2.8  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    23   2.8  
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    23   3.8  
DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    22   8.7  

>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 24.2 bits (50), Expect = 1.6
 Identities = 9/34 (26%), Positives = 19/34 (55%)
 Frame = -2

Query: 836 LHI*QKGEQSLEEVFPIHTMGKGKETYHTSLVNQ 735
           +H  Q  ++S+   +P+HT G+    +  SL ++
Sbjct: 576 IHNAQVNKRSIHNNYPVHTFGRLTSKHDNSLYDE 609


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -3

Query: 577 ILPCLGIFFLEIL 539
           I+PC+GI FL +L
Sbjct: 252 IIPCMGISFLTVL 264


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -3

Query: 577 ILPCLGIFFLEIL 539
           I+PC+GI FL +L
Sbjct: 252 IIPCMGISFLTVL 264


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -3

Query: 577 ILPCLGIFFLEIL 539
           I+PC+GI FL +L
Sbjct: 248 IIPCMGISFLTVL 260


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 23.4 bits (48), Expect = 2.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -3

Query: 577 ILPCLGIFFLEIL 539
           I+PC+GI FL +L
Sbjct: 244 IIPCVGISFLSVL 256


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 23.0 bits (47), Expect = 3.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -3

Query: 577 ILPCLGIFFLEIL 539
           I+PC+GI FL +L
Sbjct: 257 IIPCVGITFLTVL 269


>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = +2

Query: 806 GFARLSAIYGGTYI 847
           G+A+L+AI  G+YI
Sbjct: 40  GYAKLAAIKSGSYI 53


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 253,964
Number of Sequences: 438
Number of extensions: 5586
Number of successful extensions: 19
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)