SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP27_F_D02
         (796 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    22   5.7  
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    22   7.5  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   10.0 

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 5.7
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 510 PPPPPXXGG 536
           PPPPP  GG
Sbjct: 376 PPPPPIRGG 384


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 11/35 (31%), Positives = 16/35 (45%)
 Frame = +2

Query: 2   TVFPXXXLLGPXFXFGLPCVWFFXLPSXYGPRXSL 106
           T+F    L+ P       CV  F LP+  G + +L
Sbjct: 233 TLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTL 267


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.4 bits (43), Expect = 10.0
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = +2

Query: 488  PXXXXXXPPPPPP 526
            P      PPPPPP
Sbjct: 1852 PVSGSPEPPPPPP 1864


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,760
Number of Sequences: 438
Number of extensions: 3853
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25125039
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -