Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP27_F_B18
         (1217 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    25   1.8  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    22   9.5  

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 24.6 bits (51), Expect = 1.8
 Identities = 11/32 (34%), Positives = 14/32 (43%)
 Frame = +1

Query: 4   GGEIXFLPXXPXXPFRPQGXIXWGGEKXFPLF 99
           GG +  +   P   F+P G   WGG     LF
Sbjct: 541 GGPLVMVCSAPVWRFQPWGPFTWGGIGVVVLF 572


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
            channel protein.
          Length = 428

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 1110 KXXPPPPPP 1136
            K  PPPPPP
Sbjct: 340  KPAPPPPPP 348


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,206
Number of Sequences: 438
Number of extensions: 2687
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 59
effective length of database: 120,501
effective search space used: 41693346
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)