Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP26_F_O01
         (1228 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0495 + 9880714-9881196                                           29   7.5  

>09_02_0495 + 9880714-9881196
          Length = 160

 Score = 29.1 bits (62), Expect = 7.5
 Identities = 13/31 (41%), Positives = 13/31 (41%)
 Frame = -3

Query: 917 GXXPPPPXGFXXXXXXPXPGLXFXXGDXPPP 825
           G  PPPP G       P  G  F  G  PPP
Sbjct: 77  GTYPPPPPGVMPGAFAPPFGGGFPYGPAPPP 107


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.313    0.135    0.417 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,870,716
Number of Sequences: 37544
Number of extensions: 258456
Number of successful extensions: 238
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 210
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 234
length of database: 14,793,348
effective HSP length: 84
effective length of database: 11,639,652
effective search space used: 3771247248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)