SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP25_F_I07
         (868 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ555537-1|CAD88245.1|  210|Apis mellifera putative chemosensory...    25   1.2  
DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated...    22   8.4  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   8.4  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   8.4  

>AJ555537-1|CAD88245.1|  210|Apis mellifera putative chemosensory
           receptor 2 protein.
          Length = 210

 Score = 24.6 bits (51), Expect = 1.2
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = +3

Query: 273 VTPHFSANKLHAVIKGDVQNQNTFSTTFTRSA 368
           VTP    N L   ++G   N+  F+TTF  +A
Sbjct: 47  VTPPQGENMLDMDLRGIYSNRTDFTTTFRPTA 78


>DQ667193-1|ABG75745.1|  510|Apis mellifera cys-loop ligand-gated
           ion channel subunit protein.
          Length = 510

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = +1

Query: 445 KRASGKFPLEVRVWDEDDTS 504
           K  SG+ PLE   W+ ++ S
Sbjct: 333 KVGSGEIPLEEEEWENENES 352


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +1

Query: 13   YRFHYXGIP*DFWRS 57
            Y+ HY  I  D WRS
Sbjct: 1147 YKLHYEPILADMWRS 1161


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +1

Query: 13   YRFHYXGIP*DFWRS 57
            Y+ HY  I  D WRS
Sbjct: 1143 YKLHYEPILADMWRS 1157


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,672
Number of Sequences: 438
Number of extensions: 4002
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28038087
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -