SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP25_F_C09
         (909 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    23   2.9  
DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channe...    23   2.9  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    22   8.9  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    22   8.9  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    22   8.9  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    22   8.9  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    22   8.9  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    22   8.9  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    22   8.9  
DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex det...    22   8.9  
AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    22   8.9  

>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +2

Query: 212 SPGTNKWEEGRSSARWAKTMMGFLVKPV 295
           S GTN W+ GR  +   + ++  LV  V
Sbjct: 264 SGGTNHWDSGRRKSAAQRNVIRMLVAVV 291


>DQ667184-1|ABG75736.1|  489|Apis mellifera GABA-gated ion channel
           protein.
          Length = 489

 Score = 23.4 bits (48), Expect = 2.9
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = +3

Query: 225 TSGRREGLRHAGPKR 269
           T GR  GLR+ GPK+
Sbjct: 421 TYGRNAGLRYRGPKQ 435


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 566 PVFCDRIPSRP 534
           P++C   PSRP
Sbjct: 126 PIYCGNFPSRP 136


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 566 PVFCDRIPSRP 534
           P++C   PSRP
Sbjct: 126 PIYCGNFPSRP 136


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 566 PVFCDRIPSRP 534
           P++C   PSRP
Sbjct: 126 PIYCGNFPSRP 136


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 566 PVFCDRIPSRP 534
           P++C   PSRP
Sbjct: 126 PIYCGNFPSRP 136


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 566 PVFCDRIPSRP 534
           P++C   PSRP
Sbjct: 126 PIYCGNFPSRP 136


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 566 PVFCDRIPSRP 534
           P++C   PSRP
Sbjct: 126 PIYCGNFPSRP 136


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 566 PVFCDRIPSRP 534
           P++C   PSRP
Sbjct: 126 PIYCGNFPSRP 136


>DQ325081-1|ABD14095.1|  186|Apis mellifera complementary sex
           determiner protein.
          Length = 186

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -2

Query: 566 PVFCDRIPSRP 534
           P++C   PSRP
Sbjct: 129 PIYCGNFPSRP 139


>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 21.8 bits (44), Expect = 8.9
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = +3

Query: 516 ASQPAVWSRRNSVTEDRTSASRQSSAMIGDP 608
           A +PA WS R +    +T  S     +  +P
Sbjct: 327 AGRPAFWSLRKAFARKKTDYSSFGKILATEP 357


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 226,313
Number of Sequences: 438
Number of extensions: 5624
Number of successful extensions: 15
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 29509116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -