SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP25_F_B06
         (897 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.           25   2.4  
AY187041-1|AAO39755.1|  272|Anopheles gambiae putative antennal ...    24   5.5  

>CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein.
          Length = 1664

 Score = 25.4 bits (53), Expect = 2.4
 Identities = 9/12 (75%), Positives = 11/12 (91%)
 Frame = +1

Query: 301 KKKMNYPLRTNY 336
           KK ++YPLRTNY
Sbjct: 47  KKNVDYPLRTNY 58


>AY187041-1|AAO39755.1|  272|Anopheles gambiae putative antennal
           carrier protein TOL-1 protein.
          Length = 272

 Score = 24.2 bits (50), Expect = 5.5
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +1

Query: 583 MRHRWARVKQRRRQIKEKKFQNELLALVQNA-NEFSAEKYVAE 708
           +   W  V +  + I  K  ++ LLA++QN  ++  A+ +VA+
Sbjct: 223 LNDNWRPVSEALKPIIAKTIEDILLAIMQNIFHQLPADYFVAD 265


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 783,725
Number of Sequences: 2352
Number of extensions: 14034
Number of successful extensions: 25
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 96747534
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -