SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP24_F_P08
         (895 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                25   0.93 
DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like GP...    22   8.7  

>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 25.0 bits (52), Expect = 0.93
 Identities = 18/62 (29%), Positives = 25/62 (40%)
 Frame = -1

Query: 478 AALCRHSVGRTT*DLTPTVSIGTLGLANAASSIVTLTFSPLGNSNSDGNRSAIANFKPSS 299
           A + R S    T   T T   G+L  + A S +  +  S     N D N    A   P+S
Sbjct: 218 AQMGRPSYTTATMATTSTPGSGSLPASPADSGVSDVESSTSSGGNEDANLLLKARLNPNS 277

Query: 298 SI 293
           S+
Sbjct: 278 SL 279


>DQ201783-1|ABB05503.1|  381|Apis mellifera capa receptor-like
          GPCR protein.
          Length = 381

 Score = 21.8 bits (44), Expect = 8.7
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = +1

Query: 61 DSYDMWSLWSI 93
          DSYD W  W +
Sbjct: 7  DSYDFWKNWDL 17


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 222,192
Number of Sequences: 438
Number of extensions: 4459
Number of successful extensions: 5
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 58
effective length of database: 120,939
effective search space used: 28904421
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -