BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP24_F_G04
(876 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 8.5
AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 8.5
AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 8.5
AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 8.5
AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 8.5
>AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex
determiner protein.
Length = 418
Score = 21.8 bits (44), Expect = 8.5
Identities = 9/20 (45%), Positives = 15/20 (75%)
Frame = -3
Query: 196 LFRRPK*ILLNSSKSRPVKL 137
LFR PK I +N+++ + +KL
Sbjct: 119 LFRGPKGIQINATELQKIKL 138
>AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49
protein.
Length = 134
Score = 21.8 bits (44), Expect = 8.5
Identities = 11/50 (22%), Positives = 27/50 (54%)
Frame = +3
Query: 447 PRVVEHALRVLHKGEAAVVRVCRIS*RRADHDLPSGTRHQVRNGDRVLDI 596
P+ +++ +R KG+ + + S ++ H LP+G R + + + L++
Sbjct: 37 PKGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPTGFRKVLVHNVKELEV 86
>AF388659-3|AAK71993.1| 548|Apis mellifera
1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
Length = 548
Score = 21.8 bits (44), Expect = 8.5
Identities = 6/12 (50%), Positives = 8/12 (66%)
Frame = -1
Query: 363 DWTIGGHRDGML 328
+W +G H DG L
Sbjct: 518 EWKVGNHEDGYL 529
>AF388659-2|AAK71994.1| 463|Apis mellifera
1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
Length = 463
Score = 21.8 bits (44), Expect = 8.5
Identities = 6/12 (50%), Positives = 8/12 (66%)
Frame = -1
Query: 363 DWTIGGHRDGML 328
+W +G H DG L
Sbjct: 433 EWKVGNHEDGYL 444
>AF388659-1|AAK71995.1| 782|Apis mellifera
1D-myo-inositol-trisphosphate 3-kinaseisoform A protein.
Length = 782
Score = 21.8 bits (44), Expect = 8.5
Identities = 6/12 (50%), Positives = 8/12 (66%)
Frame = -1
Query: 363 DWTIGGHRDGML 328
+W +G H DG L
Sbjct: 752 EWKVGNHEDGYL 763
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 234,247
Number of Sequences: 438
Number of extensions: 5096
Number of successful extensions: 13
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28402218
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -